Synaptotagmin 12 Antibody

Images

 
Western Blot: Synaptotagmin 12 Antibody [NBP1-87001] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Synaptotagmin 12 Antibody [NBP1-87001] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Western Blot: Synaptotagmin 12 Antibody [NBP1-87001] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptotagmin 12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptotagmin 12 Protein (NBP1-87001PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptotagmin 12 Antibody

  • SRG1
  • synaptotagmin XIIsynaptotagmin-XII
  • synaptotagmin-12
  • SYT11
  • sytXII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF4736
Species: Hu
Applications: WB
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP2-38121
Species: Hu
Applications: IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-32398
Species: Hu
Applications: IHC, IHC-P
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-81588
Species: Hu
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Synaptotagmin 12 Antibody (NBP1-87001) (0)

There are no publications for Synaptotagmin 12 Antibody (NBP1-87001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 12 Antibody (NBP1-87001) (0)

There are no reviews for Synaptotagmin 12 Antibody (NBP1-87001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptotagmin 12 Antibody (NBP1-87001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptotagmin 12 Products

Bioinformatics Tool for Synaptotagmin 12 Antibody (NBP1-87001)

Discover related pathways, diseases and genes to Synaptotagmin 12 Antibody (NBP1-87001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 12 Antibody (NBP1-87001)

Discover more about diseases related to Synaptotagmin 12 Antibody (NBP1-87001).
 

Pathways for Synaptotagmin 12 Antibody (NBP1-87001)

View related products by pathway.

Research Areas for Synaptotagmin 12 Antibody (NBP1-87001)

Find related products by research area.

Blogs on Synaptotagmin 12

There are no specific blogs for Synaptotagmin 12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptotagmin 12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT12