Synaptojanin 1 Antibody

Images

 
Genetic Strategies: Knockdown Validated: Synaptojanin 1 Antibody [NBP1-87842] - (A) The levels of synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls +/- SEM. (B) A ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebellum shows moderate positivity in neuropil as well as in a subset of neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebral cortex shows positivity in neuropil as well as moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human rectum shows moderate cytoplasmic positivity in neurons in peripheral ganglia.
Reduction of pTau with synj1 knockdown in vitro. (A) The levels of pTau, Tau and synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls ± SEM. (B) A representative example of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptojanin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot -Reported in scientific literature (PMID: 26372964)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Human Brain Cerebral Peduncles Whole Tissue Lysate (Adult Whole Normal)
Control Peptide
Synaptojanin 1 Protein (NBP1-87842PEP)
Publications
Read Publications using
NBP1-87842 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32356558).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptojanin 1 Antibody

  • EC 3.1.3
  • EC 3.1.3.36
  • KIAA0910
  • polyphosphoinositide phosphatase, 10synaptojanin-1
  • Synaptic inositol-14,5-trisphosphate 5-phosphatase 1
  • synaptojanin 1

Background

Synaptojanin 1 [formerly known as synaptojanin] is an inositol 5-phosphatase which exists in two tissue specific isoforms (170 and 145 kDa). Synaptojanin is involved in clathrin-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Synaptojanin 1 Antibody (NBP1-87842)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, WB.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
WB
(3)
All Applications
Filter By Species
Human
(1)
Mouse
(6)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-87842 Applications Species
Toro CA, Hansen J, Siddiq MM et al. Synaptojanin 1 Modulates Functional Recovery After Incomplete Spinal Cord Injury in Male Apolipoprotein E Epsilon 4 Mice Neurotrauma reports 2023-07-27 [PMID: 37528868] (IHC-Fr, Mouse) IHC-Fr Mouse
Pan PY, Zhu J, Rizvi A et al. Synaptojanin1 deficiency upregulates basal autophagosome formation in astrocytes The Journal of biological chemistry 2021-06-11 [PMID: 34126070] (WB, Mouse) WB Mouse
Pan PY, Sheehan P, Wang Q et al. Synj1 Haploinsufficiency Causes Dopamine Neuron Vulnerability and alpha-synuclein Accumulation in Mice Hum. Mol. Genet. 2020-04-30 [PMID: 32356558] (Mouse) Mouse
Kuechler ER, Budzynska PM, Bernardini JP et al. Distinct features of stress granule proteins predict localization in membraneless organelle J. Mol. Biol. 2020-02-24 [PMID: 32105731] (ICC/IF, Human) ICC/IF Human
Pan PY, Li X, Wang J et al. Parkinson's disease associated LRRK2 hyperactive kinase mutant disrupts synaptic vesicle trafficking in ventral midbrain neurons. J. Neurosci. 2017-10-20 [PMID: 29054882] (Mouse) Mouse
Cao J, Gaamouch FE, Meabon JS et al. ApoE4-associated phospholipid dysregulation contributes to development of Tau hyper-phosphorylation after traumatic brain injury Sci Rep 2017-09-12 [PMID: 28900205] (WB, Mouse) WB Mouse
Zhu L, Zhong M, Elder GA et al. Phospholipid dysregulation contributes to ApoE4-associated cognitive deficits in Alzheimer's disease pathogenesis. Proc. Natl. Acad. Sci. U.S.A. 2015-09-22 [PMID: 26372964] (WB, Mouse) WB Mouse

Reviews for Synaptojanin 1 Antibody (NBP1-87842) (0)

There are no reviews for Synaptojanin 1 Antibody (NBP1-87842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptojanin 1 Antibody (NBP1-87842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Synaptojanin 1 Products

Research Areas for Synaptojanin 1 Antibody (NBP1-87842)

Find related products by research area.

Blogs on Synaptojanin 1

There are no specific blogs for Synaptojanin 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptojanin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNJ1