Genetic Strategies: Western Blot: Synaptojanin 1 Antibody [NBP1-87842] - (A) The levels of synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls +/- SEM. (B) A ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebellum shows moderate positivity in neuropil as well as in a subset of neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebral cortex shows positivity in neuropil as well as moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human rectum shows moderate cytoplasmic positivity in neurons in peripheral ganglia.
Genetic Strategies: Reduction of pTau with synj1 knockdown in vitro. (A) The levels of pTau, Tau and synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in controls ± SEM. (B) ...read more
Western Blot: Synaptojanin 1 Antibody [NBP1-87842] - Reduction of pTau with synj1 knockdown in vitro. (A) The levels of pTau, Tau & synj1 protein in N2a cells after synj1 siRNA. Results are presented as % of levels in ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Synaptojanin 1 [formerly known as synaptojanin] is an inositol 5-phosphatase which exists in two tissue specific isoforms (170 and 145 kDa). Synaptojanin is involved in clathrin-mediated endocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Synaptojanin 1 Antibody (NBP1-87842) (0)
There are no reviews for Synaptojanin 1 Antibody (NBP1-87842).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Synaptojanin 1 Antibody - BSA Free and receive a gift card or discount.