Synaptojanin 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding SYNJ1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebellum shows moderate positivity in neuropil as well as in a subset of neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human cerebral cortex shows positivity in neuropil as well as moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Synaptojanin 1 Antibody [NBP1-87842] - Staining of human rectum shows moderate cytoplasmic positivity in neurons in peripheral ganglia.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Synaptojanin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
Specificity
Specificity of human Synaptojanin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
Use in Western blot reported in scientific literature (PMID: 26372964). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Human Brain Cerebral Peduncles Whole Tissue Lysate (Adult Whole Normal)
Synaptojanin 1 Knockout HeLa Cell Lysate
Control Peptide
Synaptojanin 1 Protein (NBP1-87842PEP)
Publications
Read Publications using
NBP1-87842 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptojanin 1 Antibody

  • EC 3.1.3
  • EC 3.1.3.36
  • KIAA0910
  • polyphosphoinositide phosphatase, 10synaptojanin-1
  • Synaptic inositol-14,5-trisphosphate 5-phosphatase 1
  • synaptojanin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56977
Species: Hu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-87843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006456-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-31705
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001859-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP2-97748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Synaptojanin 1 Antibody (NBP1-87842)(5)

Reviews for Synaptojanin 1 Antibody (NBP1-87842) (0)

There are no reviews for Synaptojanin 1 Antibody (NBP1-87842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptojanin 1 Antibody (NBP1-87842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Synaptojanin 1 Products

Bioinformatics Tool for Synaptojanin 1 Antibody (NBP1-87842)

Discover related pathways, diseases and genes to Synaptojanin 1 Antibody (NBP1-87842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptojanin 1 Antibody (NBP1-87842)

Discover more about diseases related to Synaptojanin 1 Antibody (NBP1-87842).
 

Pathways for Synaptojanin 1 Antibody (NBP1-87842)

View related products by pathway.

PTMs for Synaptojanin 1 Antibody (NBP1-87842)

Learn more about PTMs related to Synaptojanin 1 Antibody (NBP1-87842).
 

Research Areas for Synaptojanin 1 Antibody (NBP1-87842)

Find related products by research area.

Blogs on Synaptojanin 1

There are no specific blogs for Synaptojanin 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptojanin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNJ1