DYRK1A Antibody (7D10)

Images

 
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10. Analysis of DYRK1A expression in Hela S3 NE.
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in PC-12 ( Cat # L012V1 ).
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in 293 ( Cat # L026V1 ).
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10 Western Blot analysis of DYRK1A expression in Hela NE ( Cat # L013V3 ).
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot: DYRK1A Antibody (7D10) [H00001859-M01] - DYRK1A monoclonal antibody (M01), clone 7D10. Western Blot analysis of DYRK1A expression in NIH/3T3 ( Cat # L018V1 ).
ELISA: DYRK1A Antibody (7D10) [H00001859-M01] - Detection limit for recombinant GST tagged DYRK1A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IP
Clone
7D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DYRK1A Antibody (7D10) Summary

Immunogen
DYRK1A (NP_001387 674 a.a. - 763 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Specificity
DYRK1A - dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DYRK1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunoprecipitation
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. IP usage reported in scientific literature (PMID 25368549). IHC usage reported in scientific literature (PMID 23220201).
Publications
Read Publications using
H00001859-M01 in the following applications:

  • IHC
    1 publication
  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DYRK1A Antibody (7D10)

  • dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  • DYRK1
  • DYRK1A
  • MNBEC 2.7.110EC 2.7.12
  • MNBH

Background

This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
AF5408
Species: Hu, Mu, Rt
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-92589
Species: Hu, Dr
Applications: WB, ICC/IF, IHC, IHC-P
AF5409
Species: Hu, Mu, Rt
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for DYRK1A Antibody (H00001859-M01)(45)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(3)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 10 of 45. Show All 45 Publications.
Publications using H00001859-M01 Applications Species
Janel N, Alexopoulos P, Badel A et al. Combined assessment of DYRK1A, BDNF and homocysteine levels as diagnostic marker for Alzheimer's disease. Transl Psychiatry 2017 Jun 20 [PMID: 28632203]
London J, Rouch C, Bui LC et al. Overexpression of the DYRK1A Gene (Dual-Specificity Tyrosine Phosphorylation-Regulated Kinase 1A) Induces Alterations of the Serotoninergic and Dopaminergic Processing in Murine Brain Tissues. Mol Neurobiol 2017 May 25 [PMID: 28540658]
Delabar JM, Latour A, Noll C et al. One-carbon cycle alterations induced by Dyrk1a dosage. Molecular Genetics and Metabolism 2014 [PMID: 27896129]
Rabaneda LG, Geribaldi-Doldan N, Murillo-Carretero M et al. Altered regulation of the Spry2/Dyrk1A/PP2A triad by homocysteine impairs neural progenitor cell proliferation. Biochim Biophys Acta 2016 Dec [PMID: 27686255]
Glenewinkel F, Cohen MJ, King CR et al. The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2. Sci Rep 2016 Jun 16 [PMID: 27307198]
Booiman T, Loukachov VV, van Dort KA et al. DYRK1A Controls HIV-1 Replication at a Transcriptional Level in an NFAT Dependent Manner. PLoS One 2015 Dec 07 [PMID: 26641855] (WB) WB
Kurabayashi N, Nguyen MD, Sanada K. DYRK1A overexpression enhances STAT activity and astrogliogenesis in a Down syndrome mouse model. EMBO Rep. 2015 Sep 15 [PMID: 26373433]
Stringer M, Abeysekera I, Dria KJ et al. Low dose EGCG treatment beginning in adolescence does not improve cognitive impairment in a Down syndrome mouse model. Pharmacol Biochem Behav. 2015 Sep 10 [PMID: 26363314]
Joshua D, Blazek, Irushi Abeysekera, Jiliang Li and Randall J, Roper. Rescue of the abnormal skeletal phenotype in Ts65Dn Down syndrome mice using genetic and therapeutic modulation of trisomic Dyrk1a. Hum Mol Genet. 2015 Jul 23 [PMID: 26206885]
Najas S, Arranz J, Lochhead PA et al. DYRK1A-mediated Cyclin D1 Degradation in Neural Stem Cells Contributes to the Neurogenic Cortical Defects in Down Syndrome. EBioMedicine. 2015 Jan 17 [PMID: 26137553]
Show All 45 Publications.

Reviews for DYRK1A Antibody (H00001859-M01) (0)

There are no reviews for DYRK1A Antibody (H00001859-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYRK1A Antibody (H00001859-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DYRK1A Antibody (H00001859-M01)

Discover related pathways, diseases and genes to DYRK1A Antibody (H00001859-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYRK1A Antibody (H00001859-M01)

Discover more about diseases related to DYRK1A Antibody (H00001859-M01).
 

Pathways for DYRK1A Antibody (H00001859-M01)

View related products by pathway.

PTMs for DYRK1A Antibody (H00001859-M01)

Learn more about PTMs related to DYRK1A Antibody (H00001859-M01).
 

Research Areas for DYRK1A Antibody (H00001859-M01)

Find related products by research area.

Blogs on DYRK1A

There are no specific blogs for DYRK1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYRK1A Antibody (7D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DYRK1A
Entrez
OMIM
Uniprot