Endophilin A1/SH3GL2 Antibody (5A6)

Images

 
Western Blot: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - SH3GL2 monoclonal antibody (M01), clone 5A6 Analysis of SH3GL2 expression in PC-12.
Immunohistochemistry-Paraffin: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Analysis of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 3 ug/ml.
Sandwich ELISA: Endophilin A1/SH3GL2 Antibody (5A6) [H00006456-M01] - Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Endophilin A1/SH3GL2 Antibody (5A6) Summary

Immunogen
SH3GL2 (NP_003017 64 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
Specificity
SH3GL2 - SH3-domain GRB2-like 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SH3GL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00006456-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Endophilin A1/SH3GL2 Antibody (5A6)

  • CNSA2
  • CNSA2FLJ25015
  • EEN-B1
  • EEN-B1bA335L15.1 (SH3-domain GRB2-like 2)
  • Endophilin A1
  • Endophilin-1
  • endophilin-A1
  • FLJ20276
  • SH3 domain protein 2A
  • SH3 domain-containing GRB2-like protein 2
  • SH3D2A
  • SH3D2AEndophilin A1 BAR domain
  • SH3-domain GRB2-like 2
  • SH3GL2
  • SH3P4
  • SH3P4endophilin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02834
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-84419
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81824
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006456-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P

Publications for Endophilin A1/SH3GL2 Antibody (H00006456-M01)(2)

Reviews for Endophilin A1/SH3GL2 Antibody (H00006456-M01) (0)

There are no reviews for Endophilin A1/SH3GL2 Antibody (H00006456-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endophilin A1/SH3GL2 Antibody (H00006456-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endophilin A1/SH3GL2 Products

Bioinformatics Tool for Endophilin A1/SH3GL2 Antibody (H00006456-M01)

Discover related pathways, diseases and genes to Endophilin A1/SH3GL2 Antibody (H00006456-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endophilin A1/SH3GL2 Antibody (H00006456-M01)

Discover more about diseases related to Endophilin A1/SH3GL2 Antibody (H00006456-M01).
 

Pathways for Endophilin A1/SH3GL2 Antibody (H00006456-M01)

View related products by pathway.

PTMs for Endophilin A1/SH3GL2 Antibody (H00006456-M01)

Learn more about PTMs related to Endophilin A1/SH3GL2 Antibody (H00006456-M01).

Blogs on Endophilin A1/SH3GL2

There are no specific blogs for Endophilin A1/SH3GL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endophilin A1/SH3GL2 Antibody (5A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL2
Entrez
OMIM
Uniprot