Synaptogyrin 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining in human cerebral cortex and pancreas tissues using anti-SYNGR3 antibody. Corresponding SYNGR3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebral cortex shows high expression.

Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image submitted by a verified customer review.

• Reactivity: Hu, Mu
• Applications: IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Synaptogyrin 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
• Marker: Synaptic Marker
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNGR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation Validated from a verified customer review
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Synaptogyrin 3 Protein (NBP2-30475PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Synaptogyrin 3 Antibody - BSA Free

• MGC20003
• synaptogyrin 3
• synaptogyrin-3

Background

The Synaptogyrin 3 gene encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Synaptogyrin 3 Antibody (NBP2-30475)(2)

Publications using NBP2-30475

• Largo-Barrientos P, Apostolo N, Creemers E, et al. Lowering Synaptogyrin-3 expression rescues Tau-induced memory defects and synaptic loss in the presence of microglial activation Neuron 2021-01-07 [PMID: 33472038]
• McInnes J, Wierda K, Snellinx A, Bounti L. Synaptogyrin-3 Mediates Presynaptic Dysfunction Induced by Tau. Neuron. 2018-02-21 [PMID: 29398363] (Human)

Review for Synaptogyrin 3 Antibody (NBP2-30475) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IP Mouse 02/16/2016

Summary

• Application: Immunoprecipitation
• Species: Mouse

Bioinformatics

• Gene Symbol: SYNGR3
• Uniprot:
  • O43761(Human)