Synaptogyrin 3 Antibody


Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining in human cerebral cortex and pancreas tissues using anti-SYNGR3 antibody. Corresponding SYNGR3 RNA-seq data more
Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P, IP
Validated by:

Orthogonal Strategies


Order Details

Synaptogyrin 3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
Synaptic Marker
Specificity of human Synaptogyrin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in a verified customer review.
Control Peptide
Synaptogyrin 3 Protein (NBP2-30475PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-30475 in the following applications:

Read Publication using NBP2-30475.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Synaptogyrin 3 Antibody

  • MGC20003
  • synaptogyrin 3
  • synaptogyrin-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP

Publications for Synaptogyrin 3 Antibody (NBP2-30475)(1)

We have publications tested in 1 confirmed species: Human.

Filter By Application
All Applications
Filter By Species
All Species

Review for Synaptogyrin 3 Antibody (NBP2-30475) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-30475:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation Synaptogyrin 3 NBP2-30475
reviewed by:
IP Mouse 02/16/2016


FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptogyrin 3 Antibody (NBP2-30475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Synaptogyrin 3 Products

Bioinformatics Tool for Synaptogyrin 3 Antibody (NBP2-30475)

Discover related pathways, diseases and genes to Synaptogyrin 3 Antibody (NBP2-30475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 3 Antibody (NBP2-30475)

Discover more about diseases related to Synaptogyrin 3 Antibody (NBP2-30475).

Pathways for Synaptogyrin 3 Antibody (NBP2-30475)

View related products by pathway.

Research Areas for Synaptogyrin 3 Antibody (NBP2-30475)

Find related products by research area.

Blogs on Synaptogyrin 3

There are no specific blogs for Synaptogyrin 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IP
Species: Mouse


Gene Symbol SYNGR3