Synaptogyrin 3 Antibody

Images

 
Immunohistochemistry: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebellum shows strong positivity in neuropil in the granular layer.
Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptogyrin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
Marker
Synaptic Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNGR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptogyrin 3 Protein (NBP2-30475PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-30475 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptogyrin 3 Antibody

  • MGC20003
  • synaptogyrin 3
  • synaptogyrin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77101
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77371
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-90119
Species: Hu
Applications: IHC, IHC-P
NBP1-81589
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20145
Species: Hu
Applications: WB, IHC, IHC-P
AF1519
Species: Hu
Applications: WB, IHC
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-30475
Species: Hu, Mu
Applications: IHC, IHC-P, IP

Publications for Synaptogyrin 3 Antibody (NBP2-30475) (0)

There are no publications for Synaptogyrin 3 Antibody (NBP2-30475).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Synaptogyrin 3 Antibody (NBP2-30475) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IP.

Reviews using NBP2-30475:
Filter by Applications
IP
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation Synaptogyrin 3 NBP2-30475
Enlarge
reviewed by:
Anonymous
IP Mouse 02/16/2016
View

Summary

ApplicationImmunoprecipitation
SpeciesMouse
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptogyrin 3 Antibody (NBP2-30475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptogyrin 3 Products

Bioinformatics Tool for Synaptogyrin 3 Antibody (NBP2-30475)

Discover related pathways, diseases and genes to Synaptogyrin 3 Antibody (NBP2-30475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 3 Antibody (NBP2-30475)

Discover more about diseases related to Synaptogyrin 3 Antibody (NBP2-30475).
 

Pathways for Synaptogyrin 3 Antibody (NBP2-30475)

View related products by pathway.

Research Areas for Synaptogyrin 3 Antibody (NBP2-30475)

Find related products by research area.

Blogs on Synaptogyrin 3

There are no specific blogs for Synaptogyrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
02/16/2016
Application: IP
Species: Mouse

Bioinformatics

Gene Symbol SYNGR3
Uniprot