Home » Synaptogyrin 3 » Synaptogyrin 3 Antibodies » Synaptogyrin 3 Antibody

Synaptogyrin 3 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining in human cerebral cortex and pancreas tissues using anti-SYNGR3 antibody. Corresponding SYNGR3 RNA-seq data ...read more
Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Synaptogyrin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
Marker
Synaptic Marker
Specificity
Specificity of human Synaptogyrin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNGR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in a verified customer review.
Control Peptide
Synaptogyrin 3 Protein (NBP2-30475PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-30475 in the following applications:
Publications
Read Publication using NBP2-30475.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptogyrin 3 Antibody

  • MGC20003
  • synaptogyrin 3
  • synaptogyrin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
CDC73/HRPT2
Antibody
NB200-184
Western Blot: CDC73/HRPT2 Antibody [NB200-184] - Detection of Human and Mouse Para fibromin by Western Blot. Samples: Whole cell lysate (50 ug) from mouse TCMK-1 and human 293T cells. Antibodies: Affinity purified rabbit anti-Parafibromin antibody NB200-184 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CDC73/HRPT2 Antibody [NB200-184] - Detection of human CDC73/HRPT2 (Parafibromin) by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HEK293T cells. Antibodies: Affinity purified rabbit anti-CDC73/HRPT2 antibody NB200-184 used for IP at 6 ug/mg lysate. For blotting immunoprecipitated CDC73/HRPT2, NB200-184 was used at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(10 Publications)
Species: Hu, Mu
Applications: WB, IP
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(42 Publications)
Species: Hu
VMAT2 Antibody
NB110-68123
VMAT2 Antibody
(8 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot: SLC6A3/DAT1 Antibody (mAb16) [NBP2-22164] - Western blot analysis of DAT protein. Band shown at approx. 75 kDa. Image submitted by verified customer review.
Immunocytochemistry/Immunofluorescence: DAT1 Antibody (mAb16) [NBP2-22164] - The DAT1 antibody was tested in PC12 cells at a 1:250 dilution against DyLight 488 (Green). Actin and nuclei were counterstained with Phalloidin-AlexaFluor 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: DAT1 Antibody (mAb16) [NBP2-22164] - IHC analysis of DAT1 in mouse brain using DAB with hematoxylin counterstain.
(3 Reviews)
(12 Publications)
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
XRCC1 Antibody
NBP1-87154
Western Blot: XRCC1 Antibody [NBP1-87154] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented
Immunocytochemistry/Immunofluorescence: XRCC1 Antibody [NBP1-87154] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: XRCC1 Antibody [NBP1-87154] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Stathmin 1 Antibody
NBP1-76798
Knockout Validated: Stathmin 1 Antibody [NBP1-76798] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Stathmin 1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1 ug/ml of Rabbit Anti-Human SIRT1 Polyclonal Antibody (Catalog # NBP1-76798) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Stathmin 1 at approximately 17 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Stathmin 1 Antibody [NBP1-76798] - EL4 cell lysate with op18 antibody at (A) 0.5, (B) 1 and (C) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Stathmin 1 Antibody [NBP1-76798] - Stathmin 1 antibody was tested in PC12 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Synaptogyrin 2
Antibody
NBP1-77101
Western Blot: Synaptogyrin 2 Antibody [NBP1-77101] - Human lung tissue lysate antibody at (A) 1 and (B) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Synaptogyrin 2 Antibody [NBP1-77101] - Immunofluorescence of SYNGR2 in rat brain tissue with SYNGR2 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: Synaptogyrin 2 Antibody [NBP1-77101] - Rat brain tissue with SYNGR2 antibody at 2.5 ug/mL.
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Synaptogyrin 1
Antibody
NBP1-77371
Western Blot: Synaptogyrin 1 Antibody [NBP1-77371] - Rat brain tissue lysate with SYNGR1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: Synaptogyrin 1 Antibody [NBP1-77371] - Immunofluorescence of SYNGR1 in rat brain tissue with SYNGR1 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: Synaptogyrin 1 Antibody [NBP1-77371] - Rat brain tissue with SYNGR1 antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Aquaporin-6
Antibody
NBP1-90119
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human lymph node shows low expression as expected.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
ITPKB Antibody
NBP1-81589
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Analysis in human cerebral cortex and liver tissues. Corresponding ITPKB RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
RGL4 Antibody
NBP2-20145
Western Blot: RGL4 Antibody [NBP2-20145] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RGL4 Antibody [NBP2-20145] - Immunohistochemical analysis of paraffin-embedded colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
p38 delta/SAPK4
Antibody [Unconjugate
AF1519
Western blot shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). For additional reference, recombinant p38 beta, p38 gamma, p38δ, and p38 alpha   at 2 ng/lane) were included. A specific band for p38 delta was detected at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using 15 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) overnight at 4 °C. Tissue was stained with the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
LANCL1 Antibody
NBP1-81796
Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Rab4 Antibody
NB100-74519
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in NIH-3T3 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Rab4 Antibody [NB100-74519] - Immunohistochemistry was performed on normal deparaffinized human Stomach tissue.
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in HeLa Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:100 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Synaptogyrin 3
Antibody
NBP2-30475
Synaptogyrin 3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, IP

Publications for Synaptogyrin 3 Antibody (NBP2-30475)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Review for Synaptogyrin 3 Antibody (NBP2-30475) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-30475:
Filter by Applications
IP
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation Synaptogyrin 3 NBP2-30475
Enlarge
reviewed by:
Anonymous
 IP Mouse 02/16/2016
View

Summary

ApplicationImmunoprecipitation
SpeciesMouse
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptogyrin 3 Antibody (NBP2-30475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Synaptogyrin 3 Products

Bioinformatics Tool for Synaptogyrin 3 Antibody (NBP2-30475)

Discover related pathways, diseases and genes to Synaptogyrin 3 Antibody (NBP2-30475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 3 Antibody (NBP2-30475)

Discover more about diseases related to Synaptogyrin 3 Antibody (NBP2-30475).
 

Pathways for Synaptogyrin 3 Antibody (NBP2-30475)

View related products by pathway.

Research Areas for Synaptogyrin 3 Antibody (NBP2-30475)

Find related products by research area.

Blogs on Synaptogyrin 3

There are no specific blogs for Synaptogyrin 3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunoprecipitation Synaptogyrin 3 NBP2-30475
Enlarge
 Anonymous
02/16/2016
Application: IP
Species: Mouse
read this review

Bioinformatics

Gene Symbol SYNGR3
Uniprot