Home » Synaptogyrin 3 » Synaptogyrin 3 Antibodies » Synaptogyrin 3 Antibody

Synaptogyrin 3 Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebellum shows strong positivity in neuropil in the granular layer.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Synaptogyrin 3 Antibody [NBP2-30475] - Staining in human cerebral cortex and pancreas tissues using anti-SYNGR3 antibody. Corresponding SYNGR3 RNA-seq data are presented for the same ...read more
Immunoprecipitation: Synaptogyrin 3 Antibody [NBP2-30475] - IP analysis of Synaptogyrin 3 in mouse brain lysates (lane 4 using NBP2-30475). Image from verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Synaptogyrin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP
Marker
Synaptic Marker
Specificity
Specificity of human Synaptogyrin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNGR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptogyrin 3 Protein (NBP2-30475PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-30475 in the following applications:
Publications
Read Publication using NBP2-30475.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptogyrin 3 Antibody

  • MGC20003
  • synaptogyrin 3
  • synaptogyrin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR Antibody
NB100-240
Western Blot: TOR/mTOR Antibody [NB100-240] - Detection of Human mTOR by Western Blot. Samples: Whole cell lysate (50, 15, 5 ug) from HeLa, and (50 ug) 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-mTOR antibody NB100-240 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TOR/mTOR Antibody [NB100-240] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. Affinity purified rabbit anti-mTOR antibody used for WB at 0.4 ug/ml (A) used for IP at 3 ug/mg lysate. mTOR was also immunoprecipitated by a previous lot of this antibody and by rabbit anti-mTOR antibodies NB100-241 and NB100-58821. For blotting immunoprecipitated mTOR, NB100-58821 was used at 1 ug/ml. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 minutes (B).
Proximity Ligation Assay: TOR/mTOR Antibody [NB100-240] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RPL26 (NBP2-22233) and rabbit anti-human mTOR (NB100-240). Image merged from DAPI (2ms) and Texas Red (100ms) exposures, 40X magnification.
(5 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
CDC73/HRPT2
Antibody
NB200-184
Western Blot: CDC73/HRPT2 Antibody [NB200-184] - Detection of Human and Mouse Para fibromin by Western Blot. Samples: Whole cell lysate (50 ug) from mouse TCMK-1 and human 293T cells. Antibodies: Affinity purified rabbit anti-Parafibromin antibody NB200-184 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: CDC73/HRPT2 Antibody [NB200-184] - Detection of Human Parafibromin on HeLa whole cell lysate using NB200-184. In B, Parafibromin was immunoprecipitated by using NB200-184 at 3 mcg/10mg with or without blocking peptide.
(10 Publications)
Species: Hu, Mu
Applications: WB, IP
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(5 Reviews)
(26 Publications)
Species: Hu
VMAT2 Antibody
NBP1-69750
Western Blot: VMAT2 Antibody [NBP1-69750] - WB analysis of VMAT2 in rat striatal tissue lysate. Image courtesy of anonymous customer product review.
Immunohistochemistry: VMAT2 Antibody [NBP1-69750] - IHC staining of VMAT2 in mouse brain cortex.
Western Blot: VMAT2 Antibody [NBP1-69750] - Analysis of VMAT2 in human brain lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione S
Transferase kappa 1 A ...
NBP1-89727
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot: DAT1 Antibody (mAb16) [NBP2-22164] - Analysis of DAT1 expression in rat striatal membrane tissue lysate.
Immunocytochemistry/Immunofluorescence: DAT1 Antibody (mAb16) [NBP2-22164] - The DAT1 antibody was tested in PC12 cells at a 1:250 dilution against DyLight 488 (Green). Actin and nuclei were counterstained with Phalloidin-AlexaFluor 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: DAT1 Antibody (mAb16) [NBP2-22164] - IHC analysis of DAT1 in mouse brain using DAB with hematoxylin counterstain.
(3 Reviews)
(11 Publications)
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
XRCC1 Antibody
(OTI2F8)
NBP2-02280
Western Blot: XRCC1 Antibody (2F8) [NBP2-02280] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY XRCC1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-XRCC1.
Immunocytochemistry/Immunofluorescence: XRCC1 Antibody (2F8) [NBP2-02280] Staining of COS7 cells transiently transfected by pCMV6-ENTRY XRCC1.
Immunohistochemistry-Paraffin: XRCC1 Antibody (2F8) [NBP2-02280] - staining of paraffin-embedded bladder tissue using anti-RC204952 mouse monoclonal antibody.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Stathmin 1 Antibody
NBP1-76798
Knockout Validated: Stathmin 1 Antibody [NBP1-76798] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Stathmin 1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1 ug/ml of Rabbit Anti-Human SIRT1 Polyclonal Antibody (Catalog # NBP1-76798) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Stathmin 1 at approximately 17 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Stathmin 1 Antibody [NBP1-76798] - EL4 cell lysate with op18 antibody at (A) 0.5, (B) 1 and (C) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Stathmin 1 Antibody [NBP1-76798] - Stathmin 1 antibody was tested in PC12 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Synaptogyrin 2
Antibody
NBP1-77101
Western Blot: Synaptogyrin 2 Antibody [NBP1-77101] - Human lung tissue lysate antibody at (A) 1 and (B) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Synaptogyrin 2 Antibody [NBP1-77101] - Immunofluorescence of SYNGR2 in rat brain tissue with SYNGR2 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: Synaptogyrin 2 Antibody [NBP1-77101] - Rat brain tissue with SYNGR2 antibody at 2.5 ug/mL.
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Synaptogyrin 1
Antibody
NBP1-77371
Western Blot: Synaptogyrin 1 Antibody [NBP1-77371] - Rat brain tissue lysate with SYNGR1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: Synaptogyrin 1 Antibody [NBP1-77371] - Immunofluorescence of SYNGR1 in rat brain tissue with SYNGR1 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: Synaptogyrin 1 Antibody [NBP1-77371] - Rat brain tissue with SYNGR1 antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Aquaporin-6
Antibody
NBP1-90119
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining in human kidney and lymph node tissues using anti-AQP6 antibody. Corresponding AQP6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ITPKB Antibody
NBP1-81589
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
RGL4 Antibody
NBP2-20145
Western Blot: RGL4 Antibody [NBP2-20145] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RGL4 Antibody [NBP2-20145] - Immunohistochemical analysis of paraffin-embedded colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
p38 delta/SAPK4
Antibody
AF1519
Western blot shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). For additional reference, recombinant p38 beta, p38 gamma, p38δ, and p38 alpha   at 2 ng/lane) were included. A specific band for p38 delta was detected at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using 15 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) overnight at 4 °C. Tissue was stained with the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, IHC
LANCL1 Antibody
NBP1-81796
Western Blot: LANCL1 Antibody [NBP1-81796] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Rab4 Antibody
NB100-74519
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in NIH-3T3 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Rab4 Antibody [NB100-74519] - Immunohistochemistry was performed on normal deparaffinized human Stomach tissue.
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in HeLa Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:100 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Synaptogyrin 3
Antibody
NBP2-30475
Synaptogyrin 3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, IP

Publications for Synaptogyrin 3 Antibody (NBP2-30475)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Review for Synaptogyrin 3 Antibody (NBP2-30475) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-30475:
Filter by Applications
IP
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation Synaptogyrin 3 NBP2-30475
Enlarge
reviewed by:
Anonymous
 IP Mouse 02/16/2016
View

Summary

ApplicationImmunoprecipitation
SpeciesMouse
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptogyrin 3 Antibody (NBP2-30475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptogyrin 3 Products

Bioinformatics Tool for Synaptogyrin 3 Antibody (NBP2-30475)

Discover related pathways, diseases and genes to Synaptogyrin 3 Antibody (NBP2-30475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 3 Antibody (NBP2-30475)

Discover more about diseases related to Synaptogyrin 3 Antibody (NBP2-30475).
 

Pathways for Synaptogyrin 3 Antibody (NBP2-30475)

View related products by pathway.

Research Areas for Synaptogyrin 3 Antibody (NBP2-30475)

Find related products by research area.

Blogs on Synaptogyrin 3

There are no specific blogs for Synaptogyrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunoprecipitation Synaptogyrin 3 NBP2-30475
Enlarge
 Anonymous
02/16/2016
Application: IP
Species: Mouse
read this review

Bioinformatics

Gene Symbol SYNGR3
Uniprot