ITPKB Antibody - BSA Free

Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Analysis in human cerebral cortex and liver tissues. Corresponding ITPKB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.

Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebellum shows strong cytoplasmic positivity in white matter.

Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITPKB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPKB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID 26642205).
• Control Peptide:

  ITPKB Protein (NBP1-81589PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITPKB Antibody - BSA Free

• EC 2.7.1.127
• inositol 14,5-trisphosphate 3-kinase BIP3K
• inositol-trisphosphate 3-kinase B
• InsP 3-kinase B
• IP3 3-kinase B
• IP3-3KB
• IP3K B
• IP3KB
• IP3K-B
• PIG37
• proliferation-inducing protein 37

Background

ITPKB is encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ITPKB Antibody (NBP1-81589)(1)

Publication using NBP1-81589

• Jin Y, Liu Y, Zhang J et al. The Expression of miR-375 Is Associated with Carcinogenesis in Three Subtypes of Lung Cancer. PLoS ONE. 2015-12-08 [PMID: 26642205] (WB, Human)

Bioinformatics

• Gene Symbol: ITPKB