ITPKB Antibody

Images

 
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong positivity in astrocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Analysis in human cerebral cortex and liver tissues. Corresponding ITPKB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebellum shows strong cytoplasmic positivity in white matter.
Immunohistochemistry-Paraffin: ITPKB Antibody [NBP1-81589] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ITPKB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE
Specificity
Specificity of human ITPKB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITPKB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 26642205)
Control Peptide
ITPKB Protein (NBP1-81589PEP)
Publications
Read Publication using
NBP1-81589 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITPKB Antibody

  • EC 2.7.1.127
  • inositol 14,5-trisphosphate 3-kinase BIP3K
  • inositol-trisphosphate 3-kinase B
  • InsP 3-kinase B
  • IP3 3-kinase B
  • IP3-3KB
  • IP3K B
  • IP3KB
  • IP3K-B
  • PIG37
  • proliferation-inducing protein 37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00253430-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-49068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-86712
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-81589
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ITPKB Antibody (NBP1-81589)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ITPKB Antibody (NBP1-81589) (0)

There are no reviews for ITPKB Antibody (NBP1-81589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITPKB Antibody (NBP1-81589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ITPKB Products

Bioinformatics Tool for ITPKB Antibody (NBP1-81589)

Discover related pathways, diseases and genes to ITPKB Antibody (NBP1-81589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITPKB Antibody (NBP1-81589)

Discover more about diseases related to ITPKB Antibody (NBP1-81589).
 

Pathways for ITPKB Antibody (NBP1-81589)

View related products by pathway.

PTMs for ITPKB Antibody (NBP1-81589)

Learn more about PTMs related to ITPKB Antibody (NBP1-81589).

Blogs on ITPKB

There are no specific blogs for ITPKB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITPKB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPKB