Synaptogyrin 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Synaptogyrin 2 Antibody [NBP2-13403] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Synaptogyrin 2 Antibody [NBP2-13403] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptogyrin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEG YQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNGR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synaptogyrin 2 Protein (NBP2-13403PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptogyrin 2 Antibody

  • cellugyrin
  • MGC102914
  • synaptogyrin 2
  • synaptogyrin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-77371
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30475
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-76316
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-56547
Species: Hu
Applications: ICC/IF
NBP1-92084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13405
Species: Hu
Applications: IHC, IHC-P
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-45910
Species: Hu
Applications: WB, IHC

Publications for Synaptogyrin 2 Antibody (NBP2-13403) (0)

There are no publications for Synaptogyrin 2 Antibody (NBP2-13403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptogyrin 2 Antibody (NBP2-13403) (0)

There are no reviews for Synaptogyrin 2 Antibody (NBP2-13403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Synaptogyrin 2 Antibody (NBP2-13403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptogyrin 2 Products

Bioinformatics Tool for Synaptogyrin 2 Antibody (NBP2-13403)

Discover related pathways, diseases and genes to Synaptogyrin 2 Antibody (NBP2-13403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 2 Antibody (NBP2-13403)

Discover more about diseases related to Synaptogyrin 2 Antibody (NBP2-13403).
 

Pathways for Synaptogyrin 2 Antibody (NBP2-13403)

View related products by pathway.

Blogs on Synaptogyrin 2

There are no specific blogs for Synaptogyrin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptogyrin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNGR2