Synaptogyrin 2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Synaptogyrin 2 Antibody [NBP2-13403] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: Synaptogyrin 2 Antibody [NBP2-13403] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Staining of human rectum strong cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human tonsil shows strong cytoplasmic-membranous positivity in non-germinal center cells.

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Synaptogyrin 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQP
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNGR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Synaptogyrin 2 Protein (NBP2-13403PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Synaptogyrin 2 Antibody - BSA Free

• cellugyrin
• MGC102914
• synaptogyrin 2
• synaptogyrin-2

Background

Synaptogyrin 2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNGR2