Aquaporin-6 Antibody


Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes. Image from verified more
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining in human kidney and lymph node tissues using anti-AQP6 antibody. Corresponding AQP6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Aquaporin-6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
Specificity of human Aquaporin-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aquaporin-6 Protein (NBP1-90119PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Aquaporin-6 Antibody

  • AQP2L
  • aquaporin 2-like, kidney specific
  • aquaporin 6, kidney specific
  • hKID
  • kidney specific


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Aquaporin-6 Antibody (NBP1-90119) (0)

There are no publications for Aquaporin-6 Antibody (NBP1-90119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-6 Antibody (NBP1-90119) (0)

There are no reviews for Aquaporin-6 Antibody (NBP1-90119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin-6 Antibody (NBP1-90119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Aquaporin-6 Products

Bioinformatics Tool for Aquaporin-6 Antibody (NBP1-90119)

Discover related pathways, diseases and genes to Aquaporin-6 Antibody (NBP1-90119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-6 Antibody (NBP1-90119)

Discover more about diseases related to Aquaporin-6 Antibody (NBP1-90119).

Pathways for Aquaporin-6 Antibody (NBP1-90119)

View related products by pathway.

PTMs for Aquaporin-6 Antibody (NBP1-90119)

Learn more about PTMs related to Aquaporin-6 Antibody (NBP1-90119).

Blogs on Aquaporin-6

There are no specific blogs for Aquaporin-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aquaporin-6 Antibody and receive a gift card or discount.


Gene Symbol AQP6