Aquaporin-6 Antibody

Images

 
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes. Image from verified ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Analysis in human kidney and pancreas tissues. Corresponding Aquaporin-6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human stomach shows moderate to strong cytoplasmic positivity in a subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Aquaporin-6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME
Specificity
Specificity of human Aquaporin-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Aquaporin-6 antibody validated for IHC-P from a verified customer review.
Control Peptide
Aquaporin-6 Protein (NBP1-90119PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90119 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aquaporin-6 Antibody

  • AQP2L
  • aquaporin 2-like, kidney specific
  • aquaporin 6, kidney specific
  • hKID
  • kidney specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-57840
Species: Hu, Mu, Rt
Applications: WB, Flow, PEP-ELISA
NBP1-87679
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30862
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-97927
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03027
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-67247
Species: Hu
Applications: WB, ICC/IF
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5285
Species: Hu
Applications: WB, Simple Western
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90119
Species: Hu
Applications: IHC, IHC-P

Publications for Aquaporin-6 Antibody (NBP1-90119) (0)

There are no publications for Aquaporin-6 Antibody (NBP1-90119).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Aquaporin-6 Antibody (NBP1-90119) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-90119:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Aquaporin-6 NBP1-90119
Enlarge
4
reviewed by:
Santhosh Sivajothi
IHC-P Human 05/22/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman kidney tissue
SpeciesHuman
LotR05381

Comments

CommentsHeat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin-6 Antibody (NBP1-90119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aquaporin-6 Products

Bioinformatics Tool for Aquaporin-6 Antibody (NBP1-90119)

Discover related pathways, diseases and genes to Aquaporin-6 Antibody (NBP1-90119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-6 Antibody (NBP1-90119)

Discover more about diseases related to Aquaporin-6 Antibody (NBP1-90119).
 

Pathways for Aquaporin-6 Antibody (NBP1-90119)

View related products by pathway.

PTMs for Aquaporin-6 Antibody (NBP1-90119)

Learn more about PTMs related to Aquaporin-6 Antibody (NBP1-90119).

Blogs on Aquaporin-6

There are no specific blogs for Aquaporin-6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Santhosh Sivajothi
05/22/2018
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol AQP6