Synaptic glycoprotein SC2 Antibody - BSA Free

Western Blot: Synaptic glycoprotein SC2 Antibody [NBP2-88390] - WB Suggested Anti-GPSN2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 293T cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Synaptic glycoprotein SC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Synaptic glycoprotein SC2 Antibody - BSA Free (NBP2-88390) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Synaptic glycoprotein SC2. Peptide sequence: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TECR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Synaptic glycoprotein SC2 Antibody - BSA Free

• EC 1.3.1
• EC 1.3.1.38
• glycoprotein, synaptic 2
• GPSN2
• Synaptic glycoprotein SC2
• TERSC2
• trans-2,3-enoyl-CoA reductase

Background

Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4sequential reactions. TER catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA (Moon andHorton, 2003 (PubMed 12482854)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TECR