MEIR5 Antibody

Images

 
Immunohistochemistry-Paraffin: MEIR5 Antibody [NBP1-90797] - Staining of human kidney shows distinct positivity in glomeruli, renal tubules showed nucleolar positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEIR5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MEIR5 Protein (NBP1-90797PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEIR5 Antibody

  • C10orf78
  • MEI5 recombination repair protein homolog
  • MEI5
  • meiosis protein 5 homolog
  • MEIR5
  • swi5-dependent recombination DNA repair protein 1 homolog
  • SWI5-dependent recombination repair 1
  • SWI5-dependent recombination repair protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-30951
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-92301
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu
Applications: WB
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00084057-T01
Species: Hu
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2987
Species: Hu
Applications: WB, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90797
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MEIR5 Antibody (NBP1-90797) (0)

There are no publications for MEIR5 Antibody (NBP1-90797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEIR5 Antibody (NBP1-90797) (0)

There are no reviews for MEIR5 Antibody (NBP1-90797). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEIR5 Antibody (NBP1-90797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEIR5 Products

Bioinformatics Tool for MEIR5 Antibody (NBP1-90797)

Discover related pathways, diseases and genes to MEIR5 Antibody (NBP1-90797). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEIR5 Antibody (NBP1-90797)

Discover more about diseases related to MEIR5 Antibody (NBP1-90797).
 

Pathways for MEIR5 Antibody (NBP1-90797)

View related products by pathway.

Blogs on MEIR5

There are no specific blogs for MEIR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEIR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFR1