| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SWAP70 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-82979 | Applications | Species |
|---|---|---|
| MV Baranov, NH Revelo, DRJ Verboogen, M Ter Beest, G van den Bo SWAP70 is a universal GEF-like adapter for tethering actin to phagosomes Small GTPases, 2018-02-09;0(0):0. 2018-02-09 [PMID: 28489960] (Western Blot, Immunocytochemistry, Human, Mouse) | Western Blot, Immunocytochemistry | Human, Mouse |
| Maksim V. Baranov, Natalia H. Revelo, Ilse Dingjan, et al. SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis. Cell Rep. 2016-11-01 [PMID: 27806292] (WB, ICC, Mouse, Human) | WB, ICC | Mouse, Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Maksim Baranov |
ICC | Human and Mouse | 11/23/2016 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SWAP70 |