![Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/SWAP70-Antibody-Western-Blot-NBP1-82979-img0008.jpg "Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SWAP70 Antibody - BSA Free (NBP1-82979) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SWAP70 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SWAP70 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publications using NBP1-82979 | Applications | Species |
|---|---|---|
| MV Baranov, NH Revelo, DRJ Verboogen, M Ter Beest, G van den Bo SWAP70 is a universal GEF-like adapter for tethering actin to phagosomes Small GTPases, 2018-02-09;0(0):0. 2018-02-09 [PMID: 28489960] (Western Blot, Immunocytochemistry, Human, Mouse) | Western Blot, Immunocytochemistry | Human, Mouse |
| Maksim V. Baranov, Natalia H. Revelo, Ilse Dingjan, et al. SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis. Cell Rep. 2016-11-01 [PMID: 27806292] (WB, ICC, Mouse, Human) | WB, ICC | Mouse, Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Maksim Baranov |
ICC | Human and Mouse | 11/23/2016 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SWAP70 |
![Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SWAP70-Antibody-Western-Blot-NBP1-82979-img0009.jpg "Western Blot: SWAP70 Antibody [NBP1-82979] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: SWAP70 Antibody [NBP1-82979] - Human dendritic cells were pulsed with FITC-labeled zymosan (zymosan-FITC; green in merge)(pink arrowheads) and latex beads (yellow arrowhead) followed by immunostaining for SWAP70 (magenta). Scale bars, 10 um. Image from a verified customer review.](http://images.novusbio.com/fullsize/SWAP70-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82979-img0010.jpg "Immunocytochemistry/Immunofluorescence: SWAP70 Antibody [NBP1-82979] - Human dendritic cells were pulsed with FITC-labeled zymosan (zymosan-FITC; green in merge)(pink arrowheads) and latex beads (yellow arrowhead) followed by immunostaining for SWAP70 (magenta). Scale bars, 10 um. Image from a verified customer review.")
![Immunohistochemistry-Paraffin: SWAP70 Antibody [NBP1-82979] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/SWAP70-Antibody-Immunohistochemistry-Paraffin-NBP1-82979-img0006.jpg "Immunohistochemistry-Paraffin: SWAP70 Antibody [NBP1-82979] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.")
![Western Blot: SWAP70 Antibody [NBP1-82979] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SWAP70-Antibody-Western-Blot-NBP1-82979-img0005.jpg "Western Blot: SWAP70 Antibody [NBP1-82979] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-21_AF594_Immunocytochemistry_6525.jpg)
![Neutralization IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/af594_mouse-il-21-affinity-purified-polyclonal-ab-neutralization-249202192915.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
