SWAP70 Antibody

Images

 
Western Blot: SWAP70 Antibody [NBP1-82979] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SWAP70 Antibody [NBP1-82979] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Western Blot: SWAP70 Antibody [NBP1-82979] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SWAP70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SWAP70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SWAP70 Protein (NBP1-82979PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82979 in the following applications:

Publications
Read Publication using
NBP1-82979 in the following applications:

  • ICC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SWAP70 Antibody

  • KIAA0640SWAP-70FLJ39540
  • SWAP switching B-cell complex 70kDa subunit
  • SWAP70
  • switch-associated protein 70

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46456
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001671-M01
Species: Hu
Applications: WB, ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-71833
Species: Hu, Mu
Applications: WB
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
594-ML/CF
Species: Mu

Publications for SWAP70 Antibody (NBP1-82979)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC, WB.


Filter By Application
ICC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Review for SWAP70 Antibody (NBP1-82979) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse and Human.
We have 1 review tested in 1 application: ICC.

Reviews using NBP1-82979:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Mouse and Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry SWAP70 NBP1-82979
Enlarge
reviewed by:
Maksim Baranov
ICC Mouse and Human 11/23/2016
View

Summary

ApplicationImmunocytochemistry
Sample TestedBlood-derived monocytes,Raw 246.7 cells
SpeciesMouse and Human

Comments

CommentsFor immunocytochemistry the 1:200 dilution was used
For Western Blot the 1:500 dilution was used

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SWAP70 Antibody (NBP1-82979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SWAP70 Products

Bioinformatics Tool for SWAP70 Antibody (NBP1-82979)

Discover related pathways, diseases and genes to SWAP70 Antibody (NBP1-82979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SWAP70 Antibody (NBP1-82979)

Discover more about diseases related to SWAP70 Antibody (NBP1-82979).
 

Pathways for SWAP70 Antibody (NBP1-82979)

View related products by pathway.

PTMs for SWAP70 Antibody (NBP1-82979)

Learn more about PTMs related to SWAP70 Antibody (NBP1-82979).

Blogs on SWAP70

There are no specific blogs for SWAP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Maksim Baranov
11/23/2016
Application: ICC
Species: Mouse and Human

Bioinformatics

Gene Symbol SWAP70
Entrez