DEF6 Antibody (1F2)

Images

 
Immunohistochemistry-Paraffin: DEF6 Antibody (1F2) [H00050619-M01] - Analysis of monoclonal antibody to DEF6 on formalin-fixed paraffin-embedded human lymph node Antibody concentration 3 ug/ml.
Sandwich ELISA: DEF6 Antibody (1F2) [H00050619-M01] - Detection limit for recombinant GST tagged DEF6 is approximately 1ng/ml as a capture antibody.
Immunoprecipitation: DEF6 Antibody (1F2) [H00050619-M01] - Analysis of DEF6 transfected lysate using anti-DEF6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DEF6 monoclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, IP
Clone
1F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DEF6 Antibody (1F2) Summary

Immunogen
DEF6 (AAH17504, 1 a.a. ~ 337 a.a) full length recombinant protein with GST tag.MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVL HIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGA FVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFN FLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQ EAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVY QELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCL
Specificity
DEF6 - differentially expressed in FDCP 6 homolog (mouse)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DEF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00050619-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DEF6 Antibody (1F2)

  • DEF-6
  • differentially expressed in FDCP 6 homolog (mouse)
  • differentially expressed in FDCP 6 homolog
  • IBPdifferentially expressed in FDCP (mouse homolog) 6
  • IRF4-binding protein
  • SLAT
  • SWAP70L
  • SWAP-70-like adaptor protein of T cells

Background

DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82979
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
594-ML/CF
Species: Mu
AF5525
Species: Hu
Applications: WB, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for DEF6 Antibody (H00050619-M01)(2)

Reviews for DEF6 Antibody (H00050619-M01) (0)

There are no reviews for DEF6 Antibody (H00050619-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEF6 Antibody (H00050619-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DEF6 Products

Bioinformatics Tool for DEF6 Antibody (H00050619-M01)

Discover related pathways, diseases and genes to DEF6 Antibody (H00050619-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEF6 Antibody (H00050619-M01)

Discover more about diseases related to DEF6 Antibody (H00050619-M01).
 

Pathways for DEF6 Antibody (H00050619-M01)

View related products by pathway.

PTMs for DEF6 Antibody (H00050619-M01)

Learn more about PTMs related to DEF6 Antibody (H00050619-M01).

Blogs on DEF6

There are no specific blogs for DEF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DEF6 Antibody (1F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol DEF6
Entrez