Surfactant Protein A Antibody (4D6) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Surfactant Protein A Antibody (4D6) - Azide and BSA Free (H00653509-M07) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
SFTPA1 (NP_001158118.1, 83 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SFTPA1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Surfactant Protein A Antibody (4D6) - Azide and BSA Free
Background
Surfactant protein A is a protein with two isoforms, with lengths of 248 and 263 amino acids and weights of approximately 26 and 28 kDa respectively. Surfactant protein A binds to surfactant phospholipids in the presence of calcium ions and helps lower the surface tension in the alveoli of the lungs. Current research is being done on several diseases and disorders linked to this protein including pulmonary fibrosis, allergic bronchopulmonary aspergillosis, pulmonary alveolar proteinosis, non-small cell lung carcinoma, sclerosing hemangioma, otitis media, chronic obstructive pulmonary disease, bronchitis obliterans, bronchopulmonary dysplasia, rhinitis, aspergillosis, pulmonary edema, insulin resistance, and pneumoconiosis. Surfactant protein A has also been shown to have interactions with DMBT1, MYO18A, C1QA, SFTPD, and TLR2 in pathways such as the immune response, bacterial infections in CF airways, cell-cell communication, phagosome, and pertussis pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: BA
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Publications for Surfactant Protein A Antibody (H00653509-M07) (0)
There are no publications for Surfactant Protein A Antibody (H00653509-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Surfactant Protein A Antibody (H00653509-M07) (0)
There are no reviews for Surfactant Protein A Antibody (H00653509-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Surfactant Protein A Antibody (H00653509-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Surfactant Protein A Products
Blogs on Surfactant Protein A