SUR1 Antibody - BSA Free

Western Blot: SUR1 Antibody [NBP1-59778] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: SUR1 Antibody [NBP1-59778] - Human small intestine tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SUR1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ABCC8(ATP-binding cassette, sub-family C (CFTR/MRP), member 8) The peptide sequence was selected from the N terminal of ABCC8. Peptide sequence PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCC8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Control:

  Human Adrenal Whole Tissue Lysate (Adult Whole Diabetes)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SUR1 Antibody - BSA Free

• ABC36
• ABCC8
• ATP-binding cassette, sub-family C (CFTR/MRP), member 8
• HHF1Sulfonylurea receptor 1
• HI
• HRINS
• PHHIHRINS
• sulfonylurea receptor (hyperinsulinemia)
• SUR
• SUR1
• SUR1MRP8
• SURATP-binding cassette transporter sub-family C member 8
• TNDM2ATP-binding cassette sub-family C member 8

Background

ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUR1 Antibody (NBP1-59778)(1)

Publication using NBP1-59778

• Vazquez-Sanchez AY, Hinojosa LM, Parraguirre-Martinez S et al. Expression of KATP channels in human cervical cancer: Potential tools for diagnosis and therapy. Oncol Lett 2018-05-01 [PMID: 29849783] (Human)

Bioinformatics

• Gene Symbol: ABCC8
• Uniprot:
  • Q09428(Human)