SUMO4 Antibody - BSA Free

Western Blot: SUMO4 Antibody [NBP2-95198] - Analysis of extracts of various cell lines, using SUMO4 at 1:800 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human kidney cancer using SUMO4 .

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human appendicitis using SUMO4 .

Immunohistochemistry-Paraffin: SUMO4 Antibody [NBP2-95198] - Paraffin-embedded human breast cancer using SUMO4 .

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUMO4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUMO4 Antibody - BSA Free (NBP2-95198) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6). LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUMO4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:300
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000-1:2000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUMO4 Antibody - BSA Free

• dJ281H8.4
• IDDM5
• small ubiquitin-like modifier 4 protein
• Small ubiquitin-like protein 4
• small ubiquitin-related modifier 4
• SMT3 suppressor of mif two 3 homolog 2
• SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
• SMT3 suppressor of mif two 3 homolog 4 (yeast)
• SMT3H4
• SUMO4
• SUMO-4

Background

SUMO4 is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUMO4