Recombinant Human Sulfatase 1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Sulfatase 1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 780-871 of Human Sulfatase 1

Source: Wheat Germ

Amino Acid Sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SULF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sulfatase 1 Protein

  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.14
  • extracellular sulfatase Sulf-1
  • FLJ30905
  • FLJ38022
  • FLJ41750
  • hSulf-1
  • KIAA1077sulfatase FP
  • SULF-1
  • sulfatase 1

Background

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00347527-P01
Species: Hu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF5057
Species: Hu
Applications: WB
259-HE/CF
Species: Hu
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-37483
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready

Publications for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02) (0)

There are no publications for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02) (0)

There are no reviews for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sulfatase 1 Products

Bioinformatics Tool for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02)

Discover related pathways, diseases and genes to Sulfatase 1 Partial Recombinant Protein (H00023213-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02)

Discover more about diseases related to Sulfatase 1 Partial Recombinant Protein (H00023213-Q02).
 

Pathways for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02)

View related products by pathway.

PTMs for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02)

Learn more about PTMs related to Sulfatase 1 Partial Recombinant Protein (H00023213-Q02).
 

Research Areas for Sulfatase 1 Partial Recombinant Protein (H00023213-Q02)

Find related products by research area.

Blogs on Sulfatase 1

There are no specific blogs for Sulfatase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sulfatase 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SULF1