SUCLA2 Antibody

Images

 
Independent Antibodies: Western Blot: SUCLA2 Antibody [NBP2-55488] - Analysis using Anti-SUCLA2 antibody NBP2-55488 (A) shows similar pattern to independent antibody NBP1-85860 (B).
Immunocytochemistry/ Immunofluorescence: SUCLA2 Antibody [NBP2-55488] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human colon.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-SUCLA2 antibody NBP2-55488 (A) shows similar ...read more
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SUCLA2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIK
Specificity
Specificity of human SUCLA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUCLA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
SUCLA2 Knockout HeLa Cell Lysate
Control Peptide
SUCLA2 Recombinant Protein Antigen (NBP2-55488PEP)

Reactivity Notes

Mouse 87%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SUCLA2 Antibody

  • A-BETA
  • ATP-specific succinyl-CoA synthetase subunit beta
  • beta subunit
  • EC 6.2.1
  • EC 6.2.1.5
  • mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta
  • MTDPS5
  • Renal carcinoma antigen NY-REN-39
  • succinate-CoA ligase, ADP-forming, beta subunit
  • succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-92801
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92505
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-57356
Species: Hu
Applications: WB
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-92828
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA
NBP1-83466
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUCLA2 Antibody (NBP2-55488) (0)

There are no publications for SUCLA2 Antibody (NBP2-55488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUCLA2 Antibody (NBP2-55488) (0)

There are no reviews for SUCLA2 Antibody (NBP2-55488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUCLA2 Antibody (NBP2-55488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUCLA2 Products

Bioinformatics Tool for SUCLA2 Antibody (NBP2-55488)

Discover related pathways, diseases and genes to SUCLA2 Antibody (NBP2-55488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUCLA2 Antibody (NBP2-55488)

Discover more about diseases related to SUCLA2 Antibody (NBP2-55488).
 

Pathways for SUCLA2 Antibody (NBP2-55488)

View related products by pathway.

PTMs for SUCLA2 Antibody (NBP2-55488)

Learn more about PTMs related to SUCLA2 Antibody (NBP2-55488).
 

Research Areas for SUCLA2 Antibody (NBP2-55488)

Find related products by research area.

Blogs on SUCLA2

There are no specific blogs for SUCLA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUCLA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUCLA2