SUCLA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-SUCLA2 antibody NBP2-55488 (A) shows similar protein distribution across tissues to independent antibody NBP1-85860 (B).

Western Blot: SUCLA2 Antibody [NBP2-55488] - Analysis using Anti-SUCLA2 antibody NBP2-55488 (A) shows similar pattern to independent antibody NBP1-85860 (B).

Immunocytochemistry/Immunofluorescence: SUCLA2 Antibody [NBP2-55488] - Staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human colon.

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human lymph node.

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-55488] - Staining of human kidney.

Simple Western: SUCLA2 Antibody [NBP2-55488] - Simple Western Lane view shows HepG2, Molt-4, U-251-MG whole cell lysate (WCL). A specific band was detected for SUCLA2 antibody (NBP2-55488) at approximately 50 kDa (as indicated) using 25 ug/mL of SUCLA2 antibody. This experiment was conducted under reducing conditions.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUCLA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUCLA2 Antibody - BSA Free (NBP2-55488) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUCLA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation
• Control Peptide:

  SUCLA2 Recombinant Protein Antigen (NBP2-55488PEP)

Reactivity Notes

Mouse 87%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUCLA2 Antibody - BSA Free

• A-BETA
• ATP-specific succinyl-CoA synthetase subunit beta
• beta subunit
• EC 6.2.1
• EC 6.2.1.5
• mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta
• MTDPS5
• Renal carcinoma antigen NY-REN-39
• succinate-CoA ligase, ADP-forming, beta subunit
• succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

Background

Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUCLA2