MPV17L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MPV17L Antibody [NBP1-83466] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: MPV17L Antibody [NBP1-83466] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPV17L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQQSGDGTFKSAFTILYTKGTSATEGYPKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPV17L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MPV17L Protein (NBP1-83466PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPV17L Antibody

  • FLJ39599
  • MGC70356
  • M-LP homolog
  • M-LPH
  • MLPH1
  • MLPH2
  • MPV17 mitochondrial membrane protein-like
  • MPV17L1
  • Mpv17-like protein type 1
  • Mpv17-like protein type 2
  • mpv17-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52097
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2819
Species: Hu
Applications: WB, ICC
NBP1-80604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-33015
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
H00171023-M05
Species: Hu
Applications: WB, ELISA

Publications for MPV17L Antibody (NBP1-83466) (0)

There are no publications for MPV17L Antibody (NBP1-83466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPV17L Antibody (NBP1-83466) (0)

There are no reviews for MPV17L Antibody (NBP1-83466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MPV17L Antibody (NBP1-83466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPV17L Products

Bioinformatics Tool for MPV17L Antibody (NBP1-83466)

Discover related pathways, diseases and genes to MPV17L Antibody (NBP1-83466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPV17L Antibody (NBP1-83466)

Discover more about diseases related to MPV17L Antibody (NBP1-83466).
 

Pathways for MPV17L Antibody (NBP1-83466)

View related products by pathway.

PTMs for MPV17L Antibody (NBP1-83466)

Learn more about PTMs related to MPV17L Antibody (NBP1-83466).

Blogs on MPV17L

There are no specific blogs for MPV17L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPV17L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPV17L