Deoxyguanosine kinase Antibody

Images

 
Western Blot: Deoxyguanosine kinase Antibody [NBP2-49251] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunohistochemistry: Deoxyguanosine kinase Antibody [NBP2-49251] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Deoxyguanosine kinase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGUOK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Deoxyguanosine kinase Recombinant Protein Antigen (NBP2-49251PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Deoxyguanosine kinase Antibody

  • deoxyguanosine kinase
  • deoxyguanosine kinase, mitochondrial
  • DGK
  • dGKmitochondrial deoxyguanosine kinase
  • EC 2.7.1.113
  • MTDPS3

Background

In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-92505
Species: Hu
Applications: IHC, IHC-P, KD, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-23368
Species: Hu
Applications: PAGE
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-13918
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49251
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Deoxyguanosine kinase Antibody (NBP2-49251) (0)

There are no publications for Deoxyguanosine kinase Antibody (NBP2-49251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deoxyguanosine kinase Antibody (NBP2-49251) (0)

There are no reviews for Deoxyguanosine kinase Antibody (NBP2-49251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Deoxyguanosine kinase Antibody (NBP2-49251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Deoxyguanosine kinase Products

Bioinformatics Tool for Deoxyguanosine kinase Antibody (NBP2-49251)

Discover related pathways, diseases and genes to Deoxyguanosine kinase Antibody (NBP2-49251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Deoxyguanosine kinase Antibody (NBP2-49251)

Discover more about diseases related to Deoxyguanosine kinase Antibody (NBP2-49251).
 

Pathways for Deoxyguanosine kinase Antibody (NBP2-49251)

View related products by pathway.

PTMs for Deoxyguanosine kinase Antibody (NBP2-49251)

Learn more about PTMs related to Deoxyguanosine kinase Antibody (NBP2-49251).
 

Research Areas for Deoxyguanosine kinase Antibody (NBP2-49251)

Find related products by research area.

Blogs on Deoxyguanosine kinase

There are no specific blogs for Deoxyguanosine kinase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Deoxyguanosine kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGUOK