STT3A Antibody - BSA Free

Immunohistochemistry-Paraffin: STT3A Antibody [NBP1-81576] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STT3A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STT3A Antibody - BSA Free (NBP1-81576) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STT3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STT3A Protein (NBP1-81576PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STT3A Antibody - BSA Free

• Integral membrane protein 1EC 2.4.1.119
• integral transmembrane protein 1
• ITM1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
• MGC9042
• Oligosaccharyl transferase subunit STT3A
• STT3, subunit of the oligosaccharyltransferase complex, homolog A (S.cerevisiae)
• STT3-AFLJ27038
• TMCB5
• transmembrane conserved
• Transmembrane protein TMC

Background

Asparagine-linked glycosylation (ALG) is one of the most common protein modification reactions in eukaryotic cells, as many proteins that are translocated across or integrated into the rough endoplasmic reticulum (RER) carry N-linked oligosaccharides. STT3A is a subunit of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. SST3A seems to be involved in the complex substrate specificity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STT3A