STI1 Antibody - BSA Free

Western Blot: STI1 Antibody [NBP2-33411] - Analysis using Anti-STIP1 antibody NBP2-33411 (A) shows similar pattern to independent antibody NBP2-32621 (B).

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human testis shows strong cytoplasmic positivity in basal cells of the seminiferous ducts.

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-STIP1 antibody NBP2-33411 (A) shows similar protein distribution across tissues to independent antibody NBP2-32621 (B).

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human pancreas.

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human colon.

Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-33411] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STI1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYS
• Predicted Species: Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STI1 Protein (NBP2-33411PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STI1 Antibody - BSA Free

• HOP
• HOPSTI1L
• Hsc70/Hsp90-organizing protein
• Hsp70/Hsp90-organizing protein
• IEF-SSP-3521
• NY-REN-11 antigen
• NY-REN-11
• Renal carcinoma antigen NY-REN-11
• STI1
• STI1L
• STI1P60
• STIP1
• stress-induced-phosphoprotein 1
• Transformation-sensitive protein IEF SSP 3521

Background

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 (PubMed 16100115)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STIP1
• Uniprot:
  • P31948(Human)