Sterol carrier protein 2 Antibody (2E9-1B3) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
SCP2 (AAH05911, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL |
| Specificity |
SCP2 - sterol carrier protein 2 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SCP2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation
- Western Blot
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Sterol carrier protein 2 Antibody (2E9-1B3) - Azide and BSA Free
Background
This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt, RM
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: WB, ELISA, IP
Publications for Sterol carrier protein 2 Antibody (H00006342-M01) (0)
There are no publications for Sterol carrier protein 2 Antibody (H00006342-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sterol carrier protein 2 Antibody (H00006342-M01) (0)
There are no reviews for Sterol carrier protein 2 Antibody (H00006342-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sterol carrier protein 2 Antibody (H00006342-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sterol carrier protein 2 Products
Blogs on Sterol carrier protein 2