Sterol carrier protein 2 Antibody (2E9-1B3)

Images

 
Western Blot: Sterol carrier protein 2 Antibody (2E9-1B3) [H00006342-M01] - Analysis of SCP2 expression in transfected 293T cell line by SCP2 monoclonal antibody (M01), clone 2E9-1B3.Lane 1: SCP2 transfected lysate ...read more
Immunoprecipitation: Sterol carrier protein 2 Antibody (2E9-1B3) [H00006342-M01] - Analysis of SCP2 transfected lysate using anti-SCP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SCP2 MaxPab ...read more
ELISA: Sterol carrier protein 2 Antibody (2E9-1B3) [H00006342-M01] - Detection limit for recombinant GST tagged SCP2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2E9-1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Sterol carrier protein 2 Antibody (2E9-1B3) Summary

Immunogen
SCP2 (AAH05911, 1 a.a. - 143 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
Specificity
SCP2 - sterol carrier protein 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sterol carrier protein 2 Antibody (2E9-1B3)

  • DKFZp686C12188
  • DKFZp686D11188
  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCP-CHI
  • SCPX
  • SCP-X
  • sterol carrier protein 2EC 2.3.1.176
  • Sterol carrier protein X

Background

This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006342-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for Sterol carrier protein 2 Antibody (H00006342-M01) (0)

There are no publications for Sterol carrier protein 2 Antibody (H00006342-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sterol carrier protein 2 Antibody (H00006342-M01) (0)

There are no reviews for Sterol carrier protein 2 Antibody (H00006342-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sterol carrier protein 2 Antibody (H00006342-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sterol carrier protein 2 Products

Bioinformatics Tool for Sterol carrier protein 2 Antibody (H00006342-M01)

Discover related pathways, diseases and genes to Sterol carrier protein 2 Antibody (H00006342-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sterol carrier protein 2 Antibody (H00006342-M01)

Discover more about diseases related to Sterol carrier protein 2 Antibody (H00006342-M01).
 

Pathways for Sterol carrier protein 2 Antibody (H00006342-M01)

View related products by pathway.

PTMs for Sterol carrier protein 2 Antibody (H00006342-M01)

Learn more about PTMs related to Sterol carrier protein 2 Antibody (H00006342-M01).

Blogs on Sterol carrier protein 2

There are no specific blogs for Sterol carrier protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sterol carrier protein 2 Antibody (2E9-1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCP2
Entrez
OMIM
Uniprot