Recombinant Human Steroid sulfatase GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Steroid sulfatase Protein [H00000412-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Steroid sulfatase Peptides and Proteins

Order Details


    • Catalog Number
      H00000412-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Steroid sulfatase GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 248-350 of Human Steroid sulfatase

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
STS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.07 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Steroid sulfatase GST (N-Term) Protein

  • ARSC1
  • ARSC1ES
  • ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S
  • Arylsulfatase C
  • ASC
  • EC 3.1.6
  • EC 3.1.6.2
  • Estrone sulfatase
  • SSDD
  • steroid sulfatase (microsomal), isozyme S
  • Steroid sulfatase
  • steryl-sulfatase
  • Steryl-sulfate sulfohydrolase
  • STS
  • XLI

Background

STS - steroid sulfatase (microsomal), arylsulfatase C, isozyme S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
7734-LF
Species: Hu
Applications: BA
7625
Species: Mu
Applications: ELISA
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB

Publications for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

There are no publications for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

There are no reviews for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Do you produce an enzymatically active human or murine steroid sulfatase? Is H00000412-Q01 enzymatically active?
    • This product is produced by a Taiwanese company called Abnova and we distribute it for them. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody. We carry a number of other sulfatase proteins including iduronate 2 sulfatase, sulfatase 1 and sulfatase 2. Most are Abnova proteins and are not predicted to be enzymatically active

Additional Steroid sulfatase Products

Research Areas for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Find related products by research area.

Blogs on Steroid sulfatase

There are no specific blogs for Steroid sulfatase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Steroid sulfatase GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STS