Recombinant Human Steroid sulfatase Protein

Images

 
SDS-Page: Recombinant Human Steroid sulfatase Protein [H00000412-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Steroid sulfatase Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 248 - 350 of Human STS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STS

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Steroid sulfatase Protein

  • ARSC1ES
  • ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S
  • Arylsulfatase C
  • ASC
  • EC 3.1.6
  • EC 3.1.6.2
  • estrone sulfatase
  • SSDD
  • steroid sulfatase (microsomal), isozyme S
  • Steroid sulfatase
  • steryl-sulfatase
  • Steryl-sulfate sulfohydrolase
  • XLI

Background

STS - steroid sulfatase (microsomal), arylsulfatase C, isozyme S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB5545
Species: Hu
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00000412-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

There are no publications for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01) (0)

There are no reviews for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Do you produce an enzymatically active human or murine steroid sulfatase? Is H00000412-Q01 enzymatically active?
    • This product is produced by a Taiwanese company called Abnova and we distribute it for them. They do not test the activity of their recombinant proteins. The proteins are produced in a cell-free wheat germ system with an N-terminal 26kDa GST-tag. Due to this expression system, in our experience, the proteins do not always undergo the same folding and post-transnational modifications they might undergo in an endogenous cell. Because of this, we do not recommend this protein for use in functional assays and do not guarantee them for this use. They are mainly intended for use in Western Blots as a positive control with their antibody. We carry a number of other sulfatase proteins including iduronate 2 sulfatase, sulfatase 1 and sulfatase 2. Most are Abnova proteins and are not predicted to be enzymatically active

Additional Steroid sulfatase Products

Bioinformatics Tool for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Discover related pathways, diseases and genes to Steroid sulfatase Partial Recombinant Protein (H00000412-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Discover more about diseases related to Steroid sulfatase Partial Recombinant Protein (H00000412-Q01).
 

Pathways for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

View related products by pathway.

PTMs for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Learn more about PTMs related to Steroid sulfatase Partial Recombinant Protein (H00000412-Q01).
 

Research Areas for Steroid sulfatase Partial Recombinant Protein (H00000412-Q01)

Find related products by research area.

Blogs on Steroid sulfatase

There are no specific blogs for Steroid sulfatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Steroid sulfatase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STS