Recombinant Human STEAP1 GST (N-Term) Protein

Images

 
SDS-Page: STEAP1 Recombinant Protein [H00026872-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human STEAP1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-339 of Human STEAP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
STEAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
63.03 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STEAP1 GST (N-Term) Protein

  • EC 1.16.1.-
  • PRSS24
  • PRSS24MGC19484
  • six transmembrane epithelial antigen of the prostate 1
  • six transmembrane epithelial antigen of the prostate
  • Six-transmembrane epithelial antigen of prostate 1
  • STEAP1
  • STEAPmetalloreductase STEAP1

Background

STEAP1( AAH11802, 1 a.a. - 340 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76823
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-68162
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-13395
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7636
Species: Hu
Applications: IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-76566
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS6332
Species: Hu, Po, Bt, Ha, Pm, Pm, Rb
Applications: IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF4629
Species: Hu
Applications: WB
NB100-402
Species: Hu, Mu, Rt, Po, Ca, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-71419
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC

Publications for STEAP1 Recombinant Protein (H00026872-P01) (0)

There are no publications for STEAP1 Recombinant Protein (H00026872-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP1 Recombinant Protein (H00026872-P01) (0)

There are no reviews for STEAP1 Recombinant Protein (H00026872-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STEAP1 Recombinant Protein (H00026872-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional STEAP1 Products

Bioinformatics Tool for STEAP1 Recombinant Protein (H00026872-P01)

Discover related pathways, diseases and genes to STEAP1 Recombinant Protein (H00026872-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP1 Recombinant Protein (H00026872-P01)

Discover more about diseases related to STEAP1 Recombinant Protein (H00026872-P01).
 

Pathways for STEAP1 Recombinant Protein (H00026872-P01)

View related products by pathway.

Research Areas for STEAP1 Recombinant Protein (H00026872-P01)

Find related products by research area.

Blogs on STEAP1

There are no specific blogs for STEAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STEAP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP1