DPH4 Antibody

Images

 
Western Blot: DPH4 Antibody [NBP1-87969] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: DPH4 Antibody [NBP1-87969] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87969] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPH4 Protein (NBP1-87969PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPH4 Antibody

  • CSL-type zinc finger-containing protein 3
  • DnaJ (Hsp40) homolog, subfamily C, member 24
  • dnaJ homolog subfamily C member 24
  • DPH4 homolog
  • DPH4, JJJ3 homolog (S. cerevisiae)
  • DPH4, JJJ3 homolog
  • DPH41700030A21Rik
  • JJJ3
  • S. cerevisiae)
  • ZCSL3
  • zinc finger, CSL domain containing 3
  • zinc finger, CSL-type containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11978
Species: Hu
NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13934
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-47473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-03732
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-01168
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
NB100-56696
Species: Hu
Applications: WB, Flow

Publications for DPH4 Antibody (NBP1-87969) (0)

There are no publications for DPH4 Antibody (NBP1-87969).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH4 Antibody (NBP1-87969) (0)

There are no reviews for DPH4 Antibody (NBP1-87969). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPH4 Antibody (NBP1-87969) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPH4 Products

Bioinformatics Tool for DPH4 Antibody (NBP1-87969)

Discover related pathways, diseases and genes to DPH4 Antibody (NBP1-87969). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH4 Antibody (NBP1-87969)

Discover more about diseases related to DPH4 Antibody (NBP1-87969).

Blogs on DPH4

There are no specific blogs for DPH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC24