DPH4 Antibody

Western Blot: DPH4 Antibody [NBP1-87969] - Analysis in control (vector only transfected HEK293T lysate) and DNAJC24 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DPH4 Antibody [NBP1-87969] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: DPH4 Antibody [NBP1-87969] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DPH4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC24
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPH4 Protein (NBP1-87969PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPH4 Antibody

• CSL-type zinc finger-containing protein 3
• DnaJ (Hsp40) homolog, subfamily C, member 24
• dnaJ homolog subfamily C member 24
• DPH4 homolog
• DPH4, JJJ3 homolog (S. cerevisiae)
• DPH4, JJJ3 homolog
• DPH41700030A21Rik
• JJJ3
• S. cerevisiae)
• ZCSL3
• zinc finger, CSL domain containing 3
• zinc finger, CSL-type containing 3

Background

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylationand inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved insynthesis of diphthamide in EEF2 (Liu et al., 2004 (PubMed 15485916)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC24