START domain containing 7 Antibody

Images

 
Immunohistochemistry: START domain containing 7 Antibody [NBP2-49433] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

START domain containing 7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YSESSRRVLLGRLWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
START domain containing 7 Recombinant Protein Antigen (NBP2-49433PEP)

Reactivity Notes

Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for START domain containing 7 Antibody

  • Gestational trophoblastic tumor protein 1
  • GTT1stAR-related lipid transfer protein 7, mitochondrial
  • StARD7
  • StAR-related lipid transfer (START) domain containing 7
  • START domain containing 7
  • START domain-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00058488-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF3399
Species: Hu, Mu
Applications: Simple Western, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-14908
Species: Hu
Applications: ICC/IF, WB
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49433
Species: Hu
Applications: IHC, IHC-P

Publications for START domain containing 7 Antibody (NBP2-49433) (0)

There are no publications for START domain containing 7 Antibody (NBP2-49433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for START domain containing 7 Antibody (NBP2-49433) (0)

There are no reviews for START domain containing 7 Antibody (NBP2-49433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for START domain containing 7 Antibody (NBP2-49433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional START domain containing 7 Products

Bioinformatics Tool for START domain containing 7 Antibody (NBP2-49433)

Discover related pathways, diseases and genes to START domain containing 7 Antibody (NBP2-49433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for START domain containing 7 Antibody (NBP2-49433)

Discover more about diseases related to START domain containing 7 Antibody (NBP2-49433).
 

Pathways for START domain containing 7 Antibody (NBP2-49433)

View related products by pathway.

PTMs for START domain containing 7 Antibody (NBP2-49433)

Learn more about PTMs related to START domain containing 7 Antibody (NBP2-49433).

Blogs on START domain containing 7

There are no specific blogs for START domain containing 7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our START domain containing 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD7