Glutaredoxin 2 Antibody


Immunocytochemistry/ Immunofluorescence: Glutaredoxin 2 Antibody [NBP1-90040] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Glutaredoxin 2 Antibody [NBP1-90040] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Glutaredoxin 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Specificity of human Glutaredoxin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutaredoxin 2 Protein (NBP1-90040PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Glutaredoxin 2 Antibody

  • bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2)
  • glutaredoxin 2
  • glutaredoxin-2, mitochondrial
  • GRX2bA101E13.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Ye
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Glutaredoxin 2 Antibody (NBP1-90040) (0)

There are no publications for Glutaredoxin 2 Antibody (NBP1-90040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutaredoxin 2 Antibody (NBP1-90040) (0)

There are no reviews for Glutaredoxin 2 Antibody (NBP1-90040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Glutaredoxin 2 Antibody (NBP1-90040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glutaredoxin 2 Products

Bioinformatics Tool for Glutaredoxin 2 Antibody (NBP1-90040)

Discover related pathways, diseases and genes to Glutaredoxin 2 Antibody (NBP1-90040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaredoxin 2 Antibody (NBP1-90040)

Discover more about diseases related to Glutaredoxin 2 Antibody (NBP1-90040).

Pathways for Glutaredoxin 2 Antibody (NBP1-90040)

View related products by pathway.

PTMs for Glutaredoxin 2 Antibody (NBP1-90040)

Learn more about PTMs related to Glutaredoxin 2 Antibody (NBP1-90040).

Research Areas for Glutaredoxin 2 Antibody (NBP1-90040)

Find related products by research area.

Blogs on Glutaredoxin 2

There are no specific blogs for Glutaredoxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glutaredoxin 2 Antibody and receive a gift card or discount.


Gene Symbol GLRX2