STARD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STARD4 Antibody [NBP2-30538] - Staining of human cell line SH-SY5Y shows localization to plasma membrane.
Immunohistochemistry-Paraffin: STARD4 Antibody [NBP2-30538] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STARD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STARD4 Protein (NBP2-30538PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STARD4 Antibody

  • StARD4
  • StAR-related lipid transfer (START) domain containing 4
  • stAR-related lipid transfer protein 4
  • START domain containing 4 sterol-regulated
  • START domain-containing protein 4
  • sterol regulated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-05592
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for STARD4 Antibody (NBP2-30538) (0)

There are no publications for STARD4 Antibody (NBP2-30538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD4 Antibody (NBP2-30538) (0)

There are no reviews for STARD4 Antibody (NBP2-30538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STARD4 Antibody (NBP2-30538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STARD4 Products

Bioinformatics Tool for STARD4 Antibody (NBP2-30538)

Discover related pathways, diseases and genes to STARD4 Antibody (NBP2-30538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD4 Antibody (NBP2-30538)

Discover more about diseases related to STARD4 Antibody (NBP2-30538).
 

Pathways for STARD4 Antibody (NBP2-30538)

View related products by pathway.

PTMs for STARD4 Antibody (NBP2-30538)

Learn more about PTMs related to STARD4 Antibody (NBP2-30538).

Blogs on STARD4

There are no specific blogs for STARD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STARD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD4
Uniprot