Recombinant Human STARD6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STARD6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 220 of Human STARD6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STARD6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STARD6 Protein

  • StAR-related lipid transfer (START) domain containing 6
  • stAR-related lipid transfer protein 6
  • START domain containing 6
  • START domain-containing protein 6

Background

Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD6 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30538
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49512
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34980
Species: Hu
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55149
Species: Hu
Applications: ICC/IF
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45720
Species: Hu
Applications: WB, IHC, IF
NBP1-86784
Species: Hu
Applications: IHC, IHC-P

Publications for STARD6 Recombinant Protein (H00147323-P01) (0)

There are no publications for STARD6 Recombinant Protein (H00147323-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD6 Recombinant Protein (H00147323-P01) (0)

There are no reviews for STARD6 Recombinant Protein (H00147323-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD6 Recombinant Protein (H00147323-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STARD6 Products

STARD6 H00147323-P01

Bioinformatics Tool for STARD6 Recombinant Protein (H00147323-P01)

Discover related pathways, diseases and genes to STARD6 Recombinant Protein (H00147323-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD6 Recombinant Protein (H00147323-P01)

Discover more about diseases related to STARD6 Recombinant Protein (H00147323-P01).
 

Pathways for STARD6 Recombinant Protein (H00147323-P01)

View related products by pathway.

Blogs on STARD6

There are no specific blogs for STARD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STARD6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD6