StAR Antibody - BSA Free

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human adrenal gland, kidney, lymph node and testis using Anti-STAR antibody NBP1-86992 (A) shows similar protein distribution across tissues to independent antibody NBP1-86993 (B).

Analysis in human adrenal gland and pancreas tissues using Anti-STAR antibody. Corresponding STAR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human lymph node.

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human testis.

Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

StAR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit StAR Antibody - BSA Free (NBP1-86992) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  StAR Protein (NBP1-86992PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for StAR Antibody - BSA Free

• cholesterol trafficker
• mitochondrial steroid acute regulatory protein
• StAR
• StARD1
• STARD1StAR-related lipid transfer (START) domain containing 1
• START domain containing 1
• START domain-containing protein 1
• steroid acute regulatory protein
• steroidogenic acute regulator
• steroidogenic acute regulatory protein
• steroidogenic acute regulatory protein, mitochondrial

Background

StAR is encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAR