StAR Antibody

Images

 
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-86992] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

StAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
StAR Protein (NBP1-86992PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for StAR Antibody

  • cholesterol trafficker
  • mitochondrial steroid acute regulatory protein
  • StAR
  • StARD1
  • STARD1StAR-related lipid transfer (START) domain containing 1
  • START domain containing 1
  • START domain-containing protein 1
  • steroid acute regulatory protein
  • steroidogenic acute regulator
  • steroidogenic acute regulatory protein
  • steroidogenic acute regulatory protein, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
PP-H7431-00
Species: Hu
Applications: WB
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-56518
Species: Hu
Applications: WB

Publications for StAR Antibody (NBP1-86992) (0)

There are no publications for StAR Antibody (NBP1-86992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for StAR Antibody (NBP1-86992) (0)

There are no reviews for StAR Antibody (NBP1-86992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for StAR Antibody (NBP1-86992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional StAR Products

Bioinformatics Tool for StAR Antibody (NBP1-86992)

Discover related pathways, diseases and genes to StAR Antibody (NBP1-86992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for StAR Antibody (NBP1-86992)

Discover more about diseases related to StAR Antibody (NBP1-86992).
 

Pathways for StAR Antibody (NBP1-86992)

View related products by pathway.

PTMs for StAR Antibody (NBP1-86992)

Learn more about PTMs related to StAR Antibody (NBP1-86992).

Blogs on StAR

There are no specific blogs for StAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our StAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAR