Stanniocalcin 2/STC-2 Antibody - BSA Free

Western Blot: Stanniocalcin 2/STC-2 Antibody [NBP1-92447] - Analysis in human cell line TD47D.

Immunocytochemistry/Immunofluorescence: Stanniocalcin 2/STC-2 Antibody [NBP1-92447] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: Stanniocalcin 2/STC-2 Antibody [NBP1-92447] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Western Blot: Stanniocalcin 2/STC-2 Antibody [NBP1-92447] - Analysis in control (vector only transfected HEK293T lysate) and STC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Stanniocalcin 2/STC-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Stanniocalcin 2/STC-2 Protein (NBP1-92447PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Stanniocalcin 2/STC-2 Antibody - BSA Free

• Stanniocalcin 2
• stanniocalcin-2
• STC2
• STC-2
• STC-2Stanniocalcin-related protein
• STC-related protein
• STCRP

Background

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STC2