Stanniocalcin 1/STC-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Stanniocalcin 1 Antibody [NBP1-87816] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Stanniocalcin 1/STC-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Stanniocalcin 1/STC-1 Protein (NBP1-87816PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Stanniocalcin 1/STC-1 Antibody

  • Stanniocalcin 1
  • stanniocalcin-1
  • STC1
  • STC-1
  • STCSTC-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2830
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-35213
Species: Hu
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
2629-FG/CF
Species: Mu
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for Stanniocalcin 1/STC-1 Antibody (NBP1-87816) (0)

There are no publications for Stanniocalcin 1/STC-1 Antibody (NBP1-87816).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stanniocalcin 1/STC-1 Antibody (NBP1-87816) (0)

There are no reviews for Stanniocalcin 1/STC-1 Antibody (NBP1-87816). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Stanniocalcin 1/STC-1 Antibody (NBP1-87816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Stanniocalcin 1/STC-1 Products

Bioinformatics Tool for Stanniocalcin 1/STC-1 Antibody (NBP1-87816)

Discover related pathways, diseases and genes to Stanniocalcin 1/STC-1 Antibody (NBP1-87816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Stanniocalcin 1/STC-1 Antibody (NBP1-87816)

Discover more about diseases related to Stanniocalcin 1/STC-1 Antibody (NBP1-87816).
 

Pathways for Stanniocalcin 1/STC-1 Antibody (NBP1-87816)

View related products by pathway.

PTMs for Stanniocalcin 1/STC-1 Antibody (NBP1-87816)

Learn more about PTMs related to Stanniocalcin 1/STC-1 Antibody (NBP1-87816).
 

Research Areas for Stanniocalcin 1/STC-1 Antibody (NBP1-87816)

Find related products by research area.

Blogs on Stanniocalcin 1/STC-1

There are no specific blogs for Stanniocalcin 1/STC-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stanniocalcin 1/STC-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STC1
Entrez