ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody

Images

 
Immunohistochemistry-Paraffin: ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody [NBP1-81364] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GAL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST6 Gal Sialyltransferase 2/ST6GAL2 Protein (NBP1-81364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody

  • Alpha 2,6-ST 2
  • beta-galactoside alpha-2,6-sialyltransferase 2
  • beta-galactoside alpha-2,6-sialyltransferase II
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2
  • EC 2.4.99
  • EC 2.4.99.1
  • FLJ30711
  • FLJ37730
  • FLJ38334
  • hST6Gal II
  • KIAA1877
  • KIAA1877St6gal2
  • sialyltransferase 2 (monosialoganglioside sialyltransferase)
  • Sialyltransferase 2
  • SIAT2
  • ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
  • ST6Gal II
  • ST6GAL2
  • St6GalII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5924
Species: Hu
Applications: WB, Simple Western
AF5357
Species: Hu
Applications: WB, IP, Neut
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85373
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
AF5964
Species: Hu
Applications: WB, IP, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-85987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4495
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
AF5165
Species: Hu, Mu
Applications: WB
NBP1-81364
Species: Hu
Applications: IHC, IHC-P

Publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364) (0)

There are no publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364) (0)

There are no reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6 Gal Sialyltransferase 2/ST6GAL2 Products

Bioinformatics Tool for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364)

Discover related pathways, diseases and genes to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364)

Discover more about diseases related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364).
 

Pathways for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364)

View related products by pathway.

PTMs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364)

Learn more about PTMs related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-81364).

Blogs on ST6 Gal Sialyltransferase 2/ST6GAL2

There are no specific blogs for ST6 Gal Sialyltransferase 2/ST6GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GAL2
Entrez