Home » SRGN » SRGN Antibodies » SRGN Antibody

SRGN Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SRGN Antibody [NBP2-88364] - WB Suggested Anti-SRGN Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell
Western Blot: SRGN Antibody [NBP2-88364] - WB Suggested Anti-SRGN Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SRGN Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SRGN. Peptide sequence: LLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SRGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGN Antibody

  • FLJ12930
  • Hematopoetic proteoglycan core protein
  • MGC9289
  • P.PG
  • Platelet proteoglycan core protein
  • platelet proteoglycan protein core
  • PPG
  • PRG1p.PG
  • PRGhematopoetic proteoglycan core peptide
  • proteoglycan 1, secretory granule
  • proteoglycan protein core for mast cell secretory granule
  • secretory granule proteoglycan 1
  • secretory granule proteoglycan core peptide
  • Secretory granule proteoglycan core protein
  • serglycin proteoglycan
  • Serglycin
  • SRGN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
Decorin Antibody
[Unconjugated]
AF143
Western blot shows lysates of human uterus tissue and human heart tissue. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Decorin at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human uterus and human heart tissue, loaded at 0.2 mg/mL. A specific band was detected for Decorin at approximately 140-149 kDa (as indicated) using 5 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Decorin was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to intralobular stromal tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(20 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
IER3 Antibody -
BSA Free
NBP1-76802
Immunohistochemistry-Paraffin: IER3 Antibody [NBP1-76802] - Human liver tissue with IEX-1 antibody at 2.5 ug/mL
Immunocytochemistry/Immunofluorescence: IER3 Antibody [NBP1-76802] - Human Brain cells with IEX-1 antibody at 20 ug/mL.
Western Blot: IER3 Antibody [NBP1-76802] - Analysis of IEX-1 in mouse skin tissue lysate with IEX-1 antibody at (A) 1 and (B) 2 ug/mL..
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cystathionase
Antibody (4E1-1B7)
H00001491-M01
Western Blot: Cystathionase Antibody (4E1-1B7) [H00001491-M01] - Analysis of CTH expression in transfected 293T cell line by CTH monoclonal antibody (M01), clone 4E1-1B7.Lane 1: CTH transfected lysate (Predicted MW: 44.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Cystathionase Antibody (4E1-1B7) [H00001491-M01] - CTH expression in K-562 ( Cat # L009V1 ).
Immunohistochemistry-Paraffin: Cystathionase Antibody (4E1-1B7) [H00001491-M01] - Immunoperoxidase of monoclonal antibody to CTH ( Cat # H00001491-M01 ) on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml]
(27 Publications)
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(3 Reviews)
(84 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Myeloperoxidase/MPO [B
DY3667
(6 Reviews)
(62 Publications)
Species: Mu
Applications: ELISA
IL-6 [HRP]
D6050
(32 Reviews)
(640 Publications)
Species: Hu
Applications: ELISA
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
CD44 Antibody
(8E2F3) - BSA Free
NBP1-47386
Flow (Intracellular): CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(16 Publications)
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Vitamin D BP
Antibody
NBP1-88027
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.
(2 Reviews)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY HSD17B4.
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of HeLa cells.
Immunohistochemistry: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
ARHGEF11 Antibody
NBP1-83314
Western Blot: ARHGEF11 Antibody [NBP1-83314] - Analysis in control (vector only transfected HEK293T lysate) and ARHGEF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ARHGEF11 Antibody [NBP1-83314] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ARHGEF11 antibody NBP1-83314 (A) shows similar protein distribution across tissues to independent antibody NBP1-83313 (B).
Immunohistochemistry-Paraffin: ARHGEF11 Antibody [NBP1-83314] - Staining of human cerebral cortex.
(2 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
SRGN Antibody
NBP2-88364
SRGN Antibody
Species: Hu
Applications: WB

Publications for SRGN Antibody (NBP2-88364) (0)

There are no publications for SRGN Antibody (NBP2-88364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGN Antibody (NBP2-88364) (0)

There are no reviews for SRGN Antibody (NBP2-88364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGN Antibody (NBP2-88364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGN Products

Bioinformatics Tool for SRGN Antibody (NBP2-88364)

Discover related pathways, diseases and genes to SRGN Antibody (NBP2-88364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGN Antibody (NBP2-88364)

Discover more about diseases related to SRGN Antibody (NBP2-88364).
 

Pathways for SRGN Antibody (NBP2-88364)

View related products by pathway.

PTMs for SRGN Antibody (NBP2-88364)

Learn more about PTMs related to SRGN Antibody (NBP2-88364).
 

Research Areas for SRGN Antibody (NBP2-88364)

Find related products by research area.

Blogs on SRGN

There are no specific blogs for SRGN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SRGN