SRGN Antibody

Images

 
Western Blot: SRGN Antibody [NBP2-88364] - WB Suggested Anti-SRGN Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRGN Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SRGN. Peptide sequence: LLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SRGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGN Antibody

  • FLJ12930
  • Hematopoetic proteoglycan core protein
  • MGC9289
  • P.PG
  • Platelet proteoglycan core protein
  • platelet proteoglycan protein core
  • PPG
  • PRG1p.PG
  • PRGhematopoetic proteoglycan core peptide
  • proteoglycan 1, secretory granule
  • proteoglycan protein core for mast cell secretory granule
  • secretory granule proteoglycan 1
  • secretory granule proteoglycan core peptide
  • Secretory granule proteoglycan core protein
  • serglycin proteoglycan
  • Serglycin
  • SRGN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF143
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-76802
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00001491-M01
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
DY3667
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP1-83314
Species: Ch, Hu
Applications: IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88364
Species: Hu
Applications: WB

Publications for SRGN Antibody (NBP2-88364) (0)

There are no publications for SRGN Antibody (NBP2-88364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGN Antibody (NBP2-88364) (0)

There are no reviews for SRGN Antibody (NBP2-88364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGN Antibody (NBP2-88364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGN Products

Bioinformatics Tool for SRGN Antibody (NBP2-88364)

Discover related pathways, diseases and genes to SRGN Antibody (NBP2-88364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGN Antibody (NBP2-88364)

Discover more about diseases related to SRGN Antibody (NBP2-88364).
 

Pathways for SRGN Antibody (NBP2-88364)

View related products by pathway.

PTMs for SRGN Antibody (NBP2-88364)

Learn more about PTMs related to SRGN Antibody (NBP2-88364).
 

Research Areas for SRGN Antibody (NBP2-88364)

Find related products by research area.

Blogs on SRGN

There are no specific blogs for SRGN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGN