SR-BI Recombinant Protein Antigen

Images

 
There are currently no images for SR-BI Recombinant Protein Antigen (NBP2-62676PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SR-BI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCARB1.

Source: E. coli

Amino Acid Sequence: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCARB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62676.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SR-BI Recombinant Protein Antigen

  • CD36 and LIMPII analogous 1
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1
  • CD36 antigen
  • CD36L1
  • CD36L1scavenger receptor class B type 1
  • CLA1 CD36 antigen-like 1
  • CLA-1 HDLQTL6
  • CLA1
  • Collagen type I receptor, thrombospondin receptor-like 1
  • HDLQTL6
  • MGC138242
  • SCARB1
  • scavenger receptor class B type III
  • scavenger receptor class B, member 1
  • SRB1 scavenger receptor class B member 1
  • SR-B1
  • SRBI
  • SR-BI

Background

SR-BI (scavenger receptor class B member 1, SCARB1) belongs to the CD36 family and acts as a cell surface lipoprotein receptor for a variety of ligands including high density lipoprotein (HDL), phospholipids, phosphatidylserine, and lipoproteins such as lipopolysaccharide (LPS). SR-BI mediates selective uptake of HDL cholesteryl (HDL-C) ester in the liver, steroidogenic tissues, and adipose tissue and facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins. SR-BI plays a role in antigen capture and cross-presentation from bacteria, parasites, and viruses such as Hepatitis C. In endothelial cells and macrophages, SR-BI is involved in anti-inflammatory and pro-survival signaling, providing protection against atherosclerosis and clearing apoptotic cells (efferocytosis) (1, 2).

At least 5 different human splice variants have been identified with theoretical molecular weights ranging from 60.9 kDa for the canonical sequence to 45 kDa for an N-terminally truncated variant (SR-BII) (3). The extracellular domain of human SR-BI (CLA-1) shares 80%, 80%, 89%, 86% and 84% aa sequence identity with mouse, rat, porcine, rabbit, and bovine SR-BI, respectively. SR-BI is highly glycosylated and removal of N-linked glycosylation reduces lipid transport.

References

1. Linton MF, Tao H, Linton EF, Yancey PG. (2017) SR-BI: A Multifunctional Receptor in Cholesterol Homeostasis and Atherosclerosis. Trends Endocrinol Metab. 28(6):461-472. PMID: 28259375

2. Hoekstra M, Sorci-Thomas M. (2017) Rediscovering scavenger receptor type BI: surprising new roles for the HDL receptor. Curr Opin Lipidol. 28(3):255-260. PMID: 28301373

3. Shen WJ, Asthana S, Kraemer FB, Azhar S. (2018) Scavenger receptor B type 1: expression, molecular regulation, and cholesterol transport function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB400-129
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, In vivo, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PLA, WB
NBP3-46020
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-62676PEP
Species: Hu
Applications: AC

Publications for SR-BI Recombinant Protein Antigen (NBP2-62676PEP) (0)

There are no publications for SR-BI Recombinant Protein Antigen (NBP2-62676PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR-BI Recombinant Protein Antigen (NBP2-62676PEP) (0)

There are no reviews for SR-BI Recombinant Protein Antigen (NBP2-62676PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SR-BI Recombinant Protein Antigen (NBP2-62676PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SR-BI Products

Research Areas for SR-BI Recombinant Protein Antigen (NBP2-62676PEP)

Find related products by research area.

Blogs on SR-BI.

ABCA1 (ATP-binding cassette transporter A1)
The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr...  Read full blog post.

ABCA1 - The Caretaker for Cholesterol Transportation
The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp...  Read full blog post.

Scavenger's Helper - SR-BI (scavenger receptor class B member 1, SCARB1)
SR-B1 belongs to the CD36 scavenger receptor family and serves as a receptor for several ligands including phospholipids, cholesterol ester, lipoproteins, phosphatidylserine, and caveolae localized HDL. It is expressed in endothelial cells, macrophage...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SR-BI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARB1