SR-AI/MSR Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SR-AI/MSR Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSR1.
  
  

  Source: E. coli

  Amino Acid Sequence: KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MSR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88125.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SR-AI/MSR Recombinant Protein Antigen

• CD204 antigen
• CD204
• Macrophage acetylated LDL receptor I and II
• macrophage scavenger receptor 1
• macrophage scavenger receptor type III
• MSR1
• phSR1
• phSR2
• SCARA1
• SCARA1macrophage scavenger receptor types I and II
• Scavenger receptor class A member 1
• scavenger receptor class A, member 1
• SR-A
• SRAI
• SR-AI

Background

Macrophage scavenger receptors (MSR) are membrane glycoproteins that mediate the recognition and uptake of a variety of macromolecules, including modified lipoproteins, advanced glycation end (AGEs) products and amyloid b-protein (Abeta). While the normal role of MSR is associated with cell adhesion and host defense mechanisms, it also has been implicated in the development of atherosclerosis and Abeta deposition in Alzheimer's disease (AD).

In cell cultures, macrophage scavenger receptor has been shown to mediate adhesion of macrophages and other cell lines to tissue culture plastic. MSR1 antibodies are useful for research on atherosclerosis, Alzheimer's disease, and host defense.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MSR1