![Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human stomach shows strong positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/SQRDL-Antibody-Immunohistochemistry-Paraffin-NBP2-48742-img0008.jpg "Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human stomach shows strong positivity in a subset of glandular cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLD |
| Predicted Species | Mouse (91%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SQOR |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SQRDL Antibody (NBP2-48742)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SQOR |
![Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SQRDL-Antibody-Immunohistochemistry-Paraffin-NBP2-48742-img0003.jpg "Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SQRDL-Antibody-Immunohistochemistry-Paraffin-NBP2-48742-img0004.jpg "Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SQRDL-Antibody-Immunohistochemistry-Paraffin-NBP2-48742-img0006.jpg "Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes.](http://images.novusbio.com/fullsize/SQRDL-Antibody-Immunohistochemistry-Paraffin-NBP2-48742-img0007.jpg "Immunohistochemistry-Paraffin: SQRDL Antibody [NBP2-48742] - Staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")