ETHE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81689] - Analysis in human colon and skeletal muscle tissues. Corresponding ETHE1 RNA-seq data are presented for the same tissues.

Western Blot: ETHE1 Antibody [NBP1-81689] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: ETHE1 Antibody [NBP1-81689] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81689] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: ETHE1 Antibody [NBP1-81689] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81689] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81689] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ETHE1 Antibody [NBP1-81689] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ETHE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ETHE1 Antibody - BSA Free (NBP1-81689) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETHE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ETHE1 Protein (NBP1-81689PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ETHE1 Antibody - BSA Free

• D83198
• EC 3.1.2.6
• ethylmalonic encephalopathy 1
• Ethylmalonic encephalopathy protein 1
• Hepatoma subtracted clone one protein
• HSCOEC 3.-
• protein ETHE1, mitochondrial
• YF13H12

Background

ETHE1 encodes a protein that is expressed in the thyroid. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ETHE1