Recombinant Human golgi transport 1 homolog B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human golgi transport 1 homolog B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-138 of Human GOLT1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GOLT1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human golgi transport 1 homolog B GST (N-Term) Protein

  • CGI-141
  • golgi transport 1 homolog B (S. cerevisiae)
  • Golgi transport 1 homolog B
  • golgi transport 1B
  • GOT1
  • GOT1A
  • hGOT1a
  • Putative NF-kappa-B-activating protein 470
  • vesicle transport protein GOT1B
  • YMR292W

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16708
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00970
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
MAB2337
Species: Hu
Applications: IP, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-75552
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for golgi transport 1 homolog B Recombinant Protein (H00051026-P01) (0)

There are no publications for golgi transport 1 homolog B Recombinant Protein (H00051026-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for golgi transport 1 homolog B Recombinant Protein (H00051026-P01) (0)

There are no reviews for golgi transport 1 homolog B Recombinant Protein (H00051026-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for golgi transport 1 homolog B Recombinant Protein (H00051026-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional golgi transport 1 homolog B Products

Bioinformatics Tool for golgi transport 1 homolog B Recombinant Protein (H00051026-P01)

Discover related pathways, diseases and genes to golgi transport 1 homolog B Recombinant Protein (H00051026-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for golgi transport 1 homolog B Recombinant Protein (H00051026-P01)

Find related products by research area.

Blogs on golgi transport 1 homolog B

There are no specific blogs for golgi transport 1 homolog B, but you can read our latest blog posts.

Customers Who Bought This Also Bought


Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human golgi transport 1 homolog B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLT1B