![Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining in human epididymis and endometrium tissues using anti-METTL7B antibody. Corresponding METTL7B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Immunohistochemistry-Paraffin-NBP2-47377-img0008.jpg "Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining in human epididymis and endometrium tissues using anti-METTL7B antibody. Corresponding METTL7B RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit METTL7B Antibody - BSA Free (NBP2-47377) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMT1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for METTL7B Antibody (NBP2-47377)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMT1B |
![Western Blot: METTL7B Antibody [NBP2-47377] - Analysis in human cell lines Caco-2 and A-431 using anti-METTL7B antibody. Corresponding METTL7B RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Western-Blot-NBP2-47377-img0010.jpg "Western Blot: METTL7B Antibody [NBP2-47377] - Analysis in human cell lines Caco-2 and A-431 using anti-METTL7B antibody. Corresponding METTL7B RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.")
![Immunocytochemistry/Immunofluorescence: METTL7B Antibody [NBP2-47377] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47377-img0005.jpg "Immunocytochemistry/Immunofluorescence: METTL7B Antibody [NBP2-47377] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules & vesicles. Antibody staining is shown in green.")
![Western Blot: METTL7B Antibody [NBP2-47377] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Western-Blot-NBP2-47377-img0003.jpg "Western Blot: METTL7B Antibody [NBP2-47377] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.")
![Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Immunohistochemistry-Paraffin-NBP2-47377-img0004.jpg "Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/METTL7B-Antibody-Immunohistochemistry-Paraffin-NBP2-47377-img0007.jpg "Immunohistochemistry-Paraffin: METTL7B Antibody [NBP2-47377] - Staining of human endometrium shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")