PLAP Antibody

Images

 
Independent Antibodies: Western Blot: PLAP Antibody [NBP1-84996] - Analysis using Anti-PLAA antibody NBP1-84996 (A) shows similar pattern to independent antibody NBP1-84997 (B).
Immunocytochemistry/ Immunofluorescence: PLAP Antibody [NBP1-84996] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PLAP Antibody [NBP1-84996] - Staining of human testis shows strong positivity in a subset of cells in seminiferus ducts.
Western Blot: PLAP Antibody [NBP1-84996] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PLAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPTADP
Specificity
Specificity of human, mouse, rat PLAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLAP Antibody

  • DOA1
  • FLJ12699
  • phospholipase A-2-activating protein
  • phospholipase A2-activating protein
  • PLAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, RNAi
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33012
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLAP Antibody (NBP1-84996) (0)

There are no publications for PLAP Antibody (NBP1-84996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAP Antibody (NBP1-84996) (0)

There are no reviews for PLAP Antibody (NBP1-84996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLAP Antibody (NBP1-84996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLAP Products

Array NBP1-84996

Bioinformatics Tool for PLAP Antibody (NBP1-84996)

Discover related pathways, diseases and genes to PLAP Antibody (NBP1-84996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAP Antibody (NBP1-84996)

Discover more about diseases related to PLAP Antibody (NBP1-84996).
 

Pathways for PLAP Antibody (NBP1-84996)

View related products by pathway.

PTMs for PLAP Antibody (NBP1-84996)

Learn more about PTMs related to PLAP Antibody (NBP1-84996).

Blogs on PLAP

There are no specific blogs for PLAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAA
COVID-19 update