SQRDL Antibody - BSA Free

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Analysis in human colon and placenta tissues using NBP1-84510 antibody. Corresponding SQRDL RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: SQRDL Antibody [NBP1-84510] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human rectum shows strong granular cytoplasm positivity in glandular cells.

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human colon shows strong granular cytoplasm positivity in glandular cells.

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human lymphoid tissues shows strong positivity in cytoplasm granular in non-germinal center cells.

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human placenta shows very weak granular cytoplasm positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human prostate shows strong granular cytoplasm positivity in glandular cells.

Analysis in mouse cell line NIH-3T3.

Analysis in human cell lines A-549 and HEK293 using Anti-SQRDL antibody. Corresponding SQRDL RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SQRDL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SQRDL Antibody - BSA Free (NBP1-84510) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SQRDL Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SQOR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SQRDL Protein (NBP1-84510PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SQRDL Antibody - BSA Free

• CGI-44
• sulfide dehydrogenase like
• sulfide quinone reductase-like (yeast)
• sulfide:quinone oxidoreductase, mitochondrial

Background

SQRDL catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. Key enzyme that regulate the activity state of the BCKD complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SQRDL Antibody (NBP1-84510)(3)

Publications using NBP1-84510

• Mellis A, Misko A, Arjune S et al. The role of glutamate oxaloacetate transaminases in sulfite biosynthesis and H2S metabolism Redox Biology 2020-01-01 [PMID: 33271457] (ICC/IF, Human, Mouse)
• Bartman CM, Schiliro M, Helan M et al. Hydrogen sulfide, oxygen, and calcium regulation in developing human airway smooth muscle FASEB J. 2020-08-10 [PMID: 32777143] (WB)
• Spinazzi M, Radaelli E, Horre K et al. Parl Deficiency In Mouse Causes Coenzyme Q Depletion, Complex III Defects, And Leigh-Like Syndrome. bioRxiv 2018-07-13 [PMID: 30578322] (WB, Mouse)

Bioinformatics

• Gene Symbol: SQOR