SQRDL Antibody

Images

 
Western Blot: SQRDL Antibody [NBP1-84510] - Analysis in human cell lines A-549 and HEK293 using Anti-SQRDL antibody. Corresponding SQRDL RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: SQRDL Antibody [NBP1-84510] - Immunofluorescent staining of human cell line A549 shows localization to mitochondria.
Immunohistochemistry-Paraffin: SQRDL Antibody [NBP1-84510] - Staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western Blot: SQRDL Antibody [NBP1-84510] - Analysis in human cell line U-2197.
Western Blot: SQRDL Antibody [NBP1-84510] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SQRDL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SQRDL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SQRDL Protein (NBP1-84510PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SQRDL Antibody

  • CGI-44
  • sulfide dehydrogenase like
  • sulfide quinone reductase-like (yeast)
  • sulfide:quinone oxidoreductase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81689
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-14964
Species: Hu
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-47377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP2-38088
Species: Hu
Applications: IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86825
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SQRDL Antibody (NBP1-84510) (0)

There are no publications for SQRDL Antibody (NBP1-84510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SQRDL Antibody (NBP1-84510) (0)

There are no reviews for SQRDL Antibody (NBP1-84510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SQRDL Antibody (NBP1-84510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SQRDL Products

Bioinformatics Tool for SQRDL Antibody (NBP1-84510)

Discover related pathways, diseases and genes to SQRDL Antibody (NBP1-84510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SQRDL Antibody (NBP1-84510)

Discover more about diseases related to SQRDL Antibody (NBP1-84510).
 

Pathways for SQRDL Antibody (NBP1-84510)

View related products by pathway.

Blogs on SQRDL

There are no specific blogs for SQRDL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SQRDL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SQRDL