SPSB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPSB2 Antibody [NBP2-30569] - Staining of human Staining of human lung cancer. shows moderate cytoplasmic positivity in macrophages.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPSB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPSB2 Antibody - BSA Free (NBP2-30569) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPSB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPSB2 Protein (NBP2-30569PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPSB2 Antibody - BSA Free

• FLJ17395
• Gene-rich cluster protein C9
• GRCC9MGC2519
• splA/ryanodine receptor domain and SOCS box containing 2
• SPRY domain-containing SOCS box protein SSB-2
• SSB-2
• SSB2SPRY domain-containing SOCS box protein 2

Background

Interacts with PARW and MET.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPSB2
• Uniprot:
  • Q99619(Human)