SPSB2 Antibody - BSA Free

Western Blot: SPSB2 Antibody [NBP1-74266] - COLO205 Cell Lysate 1ug/ml Gel Concentration 12%

Immunohistochemistry: SPSB2 Antibody [NBP1-74266] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: SPSB2 Gene name: SPSB2 Submitted by: Timur Mavlyutov, Ph. D. , Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.

• Reactivity: Hu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SPSB2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the C terminal of SPSB2. Immunizing peptide sequence IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPSB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SPSB2 Antibody - BSA Free

• FLJ17395
• Gene-rich cluster protein C9
• GRCC9MGC2519
• splA/ryanodine receptor domain and SOCS box containing 2
• SPRY domain-containing SOCS box protein SSB-2
• SSB-2
• SSB2SPRY domain-containing SOCS box protein 2

Background

This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPSB2
• Uniprot:
  • Q99619(Human)