SPRY1 Antibody

Images

 
Western Blot: SPRY1 Antibody [NBP2-57267] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SPRY1 Antibody [NBP2-57267] - Staining of human cell line Hep G2 shows localization to nucleoplasm, cytosol & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPRY1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
Specificity
Specificity of human SPRY1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRY1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPRY1 Recombinant Protein Antigen (NBP2-57267PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SPRY1 Antibody

  • Drosophila, homolog of, 1 (antagonist of FGF signaling)
  • sprouty homolog 1, antagonist of FGF signaling (Drosophila)
  • SPRY1
  • spry-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010253-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5070
Species: Hu
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5735
Species: Hu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SPRY1 Antibody (NBP2-57267) (0)

There are no publications for SPRY1 Antibody (NBP2-57267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRY1 Antibody (NBP2-57267) (0)

There are no reviews for SPRY1 Antibody (NBP2-57267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPRY1 Antibody (NBP2-57267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPRY1 Products

Bioinformatics Tool for SPRY1 Antibody (NBP2-57267)

Discover related pathways, diseases and genes to SPRY1 Antibody (NBP2-57267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRY1 Antibody (NBP2-57267)

Discover more about diseases related to SPRY1 Antibody (NBP2-57267).
 

Pathways for SPRY1 Antibody (NBP2-57267)

View related products by pathway.

PTMs for SPRY1 Antibody (NBP2-57267)

Learn more about PTMs related to SPRY1 Antibody (NBP2-57267).
 

Research Areas for SPRY1 Antibody (NBP2-57267)

Find related products by research area.

Blogs on SPRY1

There are no specific blogs for SPRY1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRY1