SPRY1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPRY1 Antibody [NBP2-37929] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPRY1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPRY1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPRY1 Recombinant Protein Antigen (NBP2-37929PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPRY1 Antibody - BSA Free

• Drosophila, homolog of, 1 (antagonist of FGF signaling)
• sprouty homolog 1, antagonist of FGF signaling (Drosophila)
• SPRY1
• spry-1

Background

Sprouty may function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPRY1
• Uniprot:
  • O43609(Human)