SPRED1 Antibody

Images

 
Western Blot: SPRED1 Antibody [NBP2-57368] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: SPRED1 Antibody [NBP2-57368] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPRED1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTP
Specificity
Specificity of human SPRED1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRED1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPRED1 Recombinant Protein Antigen (NBP2-57368PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SPRED1 Antibody

  • EVH1/Sprouty domain containing protein
  • FLJ33903
  • hSpred1
  • NFLS
  • SPRED1
  • spred-1
  • sprouty-related, EVH1 domain containing 1
  • sprouty-related, EVH1 domain-containing protein 1
  • suppressor of Ras/MAPK activation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4819
Species: Hu
Applications: WB, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010253-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-57368
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for SPRED1 Antibody (NBP2-57368) (0)

There are no publications for SPRED1 Antibody (NBP2-57368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRED1 Antibody (NBP2-57368) (0)

There are no reviews for SPRED1 Antibody (NBP2-57368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPRED1 Antibody (NBP2-57368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPRED1 Products

Bioinformatics Tool for SPRED1 Antibody (NBP2-57368)

Discover related pathways, diseases and genes to SPRED1 Antibody (NBP2-57368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRED1 Antibody (NBP2-57368)

Discover more about diseases related to SPRED1 Antibody (NBP2-57368).
 

Pathways for SPRED1 Antibody (NBP2-57368)

View related products by pathway.

PTMs for SPRED1 Antibody (NBP2-57368)

Learn more about PTMs related to SPRED1 Antibody (NBP2-57368).

Blogs on SPRED1

There are no specific blogs for SPRED1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRED1