![Western Blot: Nicalin Antibody [NBP1-81002] - Analysis of mouse brain lysate. Image from verified customer review.](http://images.novusbio.com/fullsize2/Nicalin-Antibody-Western-Blot-NBP1-81002-img0004.jpg "Western Blot: Nicalin Antibody [NBP1-81002] - Analysis of mouse brain lysate. Image from verified customer review.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQSKAVSDWLIASVE |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCLN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western blot data on mouse from customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-ELISA-H00408050-M03-100ug-img0001.jpg)
-Western-Blot-H00408050-M03-100ug-img0002.jpg)
-Western-Blot-H00408050-M03-100ug-img0003.jpg)
-Flow-Cytometry-NBP2-75632-img0001.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-75632-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-75632-img0003.jpg)
-Immunohistochemistry-Frozen-NBP2-13075-img0018.jpg)
-Immunohistochemistry-NBP2-13075-img0019.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-13075-img0009.jpg)
| Publication using NBP1-81002 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 12/03/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for Nicalin Antibody (NBP1-81002)Discover more about diseases related to Nicalin Antibody (NBP1-81002).
| Pathways for Nicalin Antibody (NBP1-81002)View related products by pathway.
|
PTMs for Nicalin Antibody (NBP1-81002)Learn more about PTMs related to Nicalin Antibody (NBP1-81002).
| Research Areas for Nicalin Antibody (NBP1-81002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Nicalin Antibody [NBP1-81002] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/Nicalin-Antibody-Immunohistochemistry-Paraffin-NBP1-81002-img0005.jpg "Immunohistochemistry-Paraffin: Nicalin Antibody [NBP1-81002] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
