Nicalin Antibody

Images

 
Western Blot: Nicalin Antibody [NBP1-81002] - Analysis of mouse brain lysate. Image from verified customer review.
Immunohistochemistry-Paraffin: Nicalin Antibody [NBP1-81002] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicalin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQSKAVSDWLIASVE
Specificity
Specificity of human, mouse Nicalin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western blot data on mouse from customer review.
Control Peptide
Nicalin Protein (NBP1-81002PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-81002 in the following applications:

Publications
Read Publication using NBP1-81002.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nicalin Antibody

  • Ncl-1
  • NCLN
  • NET59
  • nicalin homolog (zebrafish)
  • nicalin homolog (zebrefish)
  • Nicalin
  • Nicastrin-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00408050-Q01
Species: Hu
AF3755
Species: Hu
Applications: WB
NBP1-77269
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-32112
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-75632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-57070
Species: Hu
Applications: WB
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF746
Species: Hu, Mu
Applications: WB
NBP1-81002
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Nicalin Antibody (NBP1-81002)(1)

Review for Nicalin Antibody (NBP1-81002) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-81002:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Nicalin NBP1-81002
Enlarge
reviewed by:
Margaret Harvey
WB Mouse 12/03/2014
View

Summary

ApplicationWestern Blot
SpeciesMouse
Special ApplicationsAfter speaking with your Tech Support, I tried the antibody (NBP1-81002) for western blotting, which is not one of the applications listed. The protein is Nicalin. Loading 10 ug of mouse brain lysate, I received a distinct band at the expected molecular weight (~ 63 kDa), very clean. Taking note of the Nicalin antibody you offer that can indeed be used for western blotting (NBP2-19493), the spec sheet recommended 1:500-1:3000. Also taking note of the Nicalin antibody that I was trying (NBP1-81002), the concentration being 0.05 ug/ul, I used an equivalent quantity of antibody to test it at the 1:500 dilution (this required I use 40 ul of antibody in 1 ml blocking buffer). While use of such might make this antibody not economical, it does indeed work for western blotting. Please let me know what other information you need to post a review. The gel was 7.5%, the primary antibody was incubated O/N at 4 degrees in 5% milk buffer/0.05% Tween 20; the marker is Magic Mark XP from Invitrogen, the bands being, from HMW to LMW, in kDa as follows: 220, 120, 100, 80, 60, 50, 40, 30 (with 20 immediately below). The secondary antibody was a donkey anti-rabbit HRP-conjugate used at 1:7,500. The exposure is 20 min.
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nicalin Antibody (NBP1-81002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nicalin Antibody (NBP1-81002)

Discover related pathways, diseases and genes to Nicalin Antibody (NBP1-81002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicalin Antibody (NBP1-81002)

Discover more about diseases related to Nicalin Antibody (NBP1-81002).
 

Pathways for Nicalin Antibody (NBP1-81002)

View related products by pathway.

PTMs for Nicalin Antibody (NBP1-81002)

Learn more about PTMs related to Nicalin Antibody (NBP1-81002).

Blogs on Nicalin

There are no specific blogs for Nicalin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Margaret Harvey
12/03/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol NCLN
Entrez