SPOP Antibody

Images

 
Western Blot: SPOP Antibody [H00008405-B01P] - Analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate(41.14 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SPOP Antibody [H00008405-B01P] - Analysis of purified antibody to SPOP on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPOP Antibody Summary

Immunogen
SPOP (NP_001007227.1, 1 a.a. - 374 a.a.) full-length human protein. MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Specificity
SPOP - speckle-type POZ protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SPOP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.
Publications
Read Publications using
H00008405-B01P in the following applications:

  • 1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPOP Antibody

  • HIB homolog 1
  • Roadkill homolog 1
  • speckle-type POZ protein
  • TEF2

Background

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPOP Antibody (H00008405-B01P)(2)

Reviews for SPOP Antibody (H00008405-B01P) (0)

There are no reviews for SPOP Antibody (H00008405-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPOP Antibody (H00008405-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPOP Products

Bioinformatics Tool for SPOP Antibody (H00008405-B01P)

Discover related pathways, diseases and genes to SPOP Antibody (H00008405-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPOP Antibody (H00008405-B01P)

Discover more about diseases related to SPOP Antibody (H00008405-B01P).
 

Pathways for SPOP Antibody (H00008405-B01P)

View related products by pathway.

PTMs for SPOP Antibody (H00008405-B01P)

Learn more about PTMs related to SPOP Antibody (H00008405-B01P).

Blogs on SPOP

There are no specific blogs for SPOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPOP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPOP
Entrez
Uniprot